Clone IP04020 Report

Search the DGRC for IP04020

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:40
Well:20
Vector:pOT2
Associated Gene/TranscriptCG12655-RA
Protein status:IP04020.pep: gold
Preliminary Size:426
Sequenced Size:602

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12655 2005-01-01 Successful iPCR screen
CG12655 2008-04-29 Release 5.5 accounting
CG12655 2008-08-15 Release 5.9 accounting
CG12655 2008-12-18 5.12 accounting

Clone Sequence Records

IP04020.complete Sequence

602 bp (602 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023044

> IP04020.complete
GAAAACATGTCGAATTTCAATCGCATTCTGATCGTCATTGTTATCGGATT
GGCACTAGTTCATTTTAGTGCTGTGGATGCCCAGGCCGGAACGGTGCACT
GGAACAATGGAAATGCGGCCGGCGTTGGCGTCTATTCGAGCGCCCAGTCC
GGCGGGATGCATCCGCCGGGAAGTCTGAGTGGCCAGGATCCGCAGTTCAG
CTACGGATACGCCGGCATCGATTCGCGTGGTACCTACGGTGGAGCGGGTG
GCAATGGAGCCTACTACGTGAGCGGTACGGACGAGCACGGTCGTCCCTTC
TCCTACAACAACCAGGTGGGCCATCCCGGCCAGCCGGGCTACATGGGCGT
ACGGCCGGACCCCAACTACCCGGGTACCTATGGCTACCAGAATGGCGGAG
CAATCATCGGCAGCTCGGTGGGCGTCACCGTGACCATAGCACTTGGATTG
GCCTTGGGCGGCATGAGATTTTGATGCGGTTGCAGTGTGGGATCGTTTTT
TTTTTTTGTGAATTAGTCTCTAAGCTTAATTTATGTAAACTTTTCAGTTG
TGTAAATTCTTTACTAAATTTACTAAAACATAAAAAAAAAAAAAAAAAAA
AA

IP04020.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12655-RA 915 CG12655-RA 221..802 1..582 2910 100 Plus
CG32511-RA 306 CG32511-RA 52..306 220..474 1080 94.9 Plus
CG32821-RA 330 CG32821-RA 216..330 360..474 560 99.1 Plus
CG32821-RA 330 CG32821-RA 111..216 243..348 500 98.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19846996..19847518 581..59 2555 99.2 Minus
chrX 22417052 chrX 19798771..19799121 581..220 1490 95.3 Minus
chrX 22417052 chrX 19803935..19804285 581..220 1490 95.3 Minus
chrX 22417052 chrX 19827648..19827996 581..220 1425 94.2 Minus
chrX 22417052 chrX 19817832..19818180 581..220 1410 93.9 Minus
chrX 22417052 chrX 21021435..21021775 559..220 1400 94.7 Minus
chrX 22417052 chrX 19809089..19809335 581..336 1185 99.6 Minus
chrX 22417052 chrX 19822948..19823192 581..336 1180 99.6 Minus
chrX 22417052 chrX 19837527..19837774 581..336 1175 99.2 Minus
chrX 22417052 chrX 19842262..19842509 581..336 1175 99.2 Minus
chrX 22417052 chrX 19832801..19833044 581..336 1165 99.2 Minus
chr3R 27901430 chr3R 2527119..2527227 425..317 470 95.4 Minus
chrX 22417052 chrX 19847904..19847976 73..1 365 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:29:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19958392..19958915 582..59 2560 99.2 Minus
X 23542271 X 19910167..19910518 582..220 1495 95.3 Minus
X 23542271 X 19915331..19915682 582..220 1495 95.3 Minus
X 23542271 X 19939044..19939393 582..220 1430 94.2 Minus
X 23542271 X 19929228..19929577 582..220 1415 93.9 Minus
X 23542271 X 21156254..21156618 585..220 1405 93.5 Minus
X 23542271 X 19920485..19920732 582..336 1190 99.6 Minus
X 23542271 X 19934344..19934589 582..336 1185 99.6 Minus
X 23542271 X 19948923..19949171 582..336 1180 99.2 Minus
X 23542271 X 19953658..19953906 582..336 1180 99.2 Minus
X 23542271 X 19944197..19944441 582..336 1170 99.2 Minus
3R 32079331 3R 6701328..6701436 425..317 470 95.4 Minus
X 23542271 X 19959301..19959373 73..1 365 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19966490..19967013 582..59 2560 99.2 Minus
X 23527363 X 21141346..21141710 585..220 1425 93.4 Minus
X 23527363 X 19928583..19928830 582..336 1200 99.5 Minus
X 23527363 X 19942442..19942687 582..336 1195 99.5 Minus
X 23527363 X 19961756..19962004 582..336 1190 99.1 Minus
X 23527363 X 19957021..19957269 582..336 1190 99.1 Minus
X 23527363 X 19952295..19952539 582..336 1180 99.1 Minus
X 23527363 X 19923429..19923652 582..360 1065 99.1 Minus
X 23527363 X 19918265..19918488 582..360 1065 99.1 Minus
X 23527363 X 19947142..19947363 582..360 1060 99.1 Minus
X 23527363 X 19937326..19937547 582..360 1060 99.1 Minus
X 23527363 X 19923652..19923780 348..220 600 97.6 Minus
X 23527363 X 19918488..19918616 348..220 600 97.6 Minus
X 23527363 X 19947363..19947491 348..220 540 94.5 Minus
X 23527363 X 19937547..19937675 348..220 525 93.7 Minus
3R 31820162 3R 6442159..6442267 425..317 470 95.4 Minus
X 23527363 X 19967399..19967471 73..1 365 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:29:43 has no hits.

IP04020.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:30:40 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19846996..19847503 74..581 100 <- Minus
chrX 19847904..19847976 1..73 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:31 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 1..468 7..474 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:42 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 1..468 7..474 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:57 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 1..468 7..474 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:32 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 1..468 7..474 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:07:20 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 1..468 7..474 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:25:31 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 16..596 1..581 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:42 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 16..596 1..581 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:57 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 31..611 1..581 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:32 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 16..596 1..581 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:07:20 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
CG12655-RA 31..611 1..581 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:40 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
X 19958393..19958900 74..581 100 <- Minus
X 19959301..19959373 1..73 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:40 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
X 19958393..19958900 74..581 100 <- Minus
X 19959301..19959373 1..73 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:30:40 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
X 19958393..19958900 74..581 100 <- Minus
X 19959301..19959373 1..73 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:57 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19852426..19852933 74..581 100 <- Minus
arm_X 19853334..19853406 1..73 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:06 Download gff for IP04020.complete
Subject Subject Range Query Range Percent Splice Strand
X 19967399..19967471 1..73 100   Minus
X 19966491..19966998 74..581 100 <- Minus

IP04020.pep Sequence

Translation from 0 to 473

> IP04020.pep
ENMSNFNRILIVIVIGLALVHFSAVDAQAGTVHWNNGNAAGVGVYSSAQS
GGMHPPGSLSGQDPQFSYGYAGIDSRGTYGGAGGNGAYYVSGTDEHGRPF
SYNNQVGHPGQPGYMGVRPDPNYPGTYGYQNGGAIIGSSVGVTVTIALGL
ALGGMRF*

IP04020.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20459-PA 153 GF20459-PA 12..146 13..153 388 69.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18017-PA 155 GG18017-PA 1..154 3..156 596 85.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24333-PA 149 GH24333-PA 51..105 49..103 175 81.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG12655-PA 155 CG12655-PA 1..155 3..157 834 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14818-PA 152 GI14818-PA 6..128 7..132 199 53.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12928-PA 164 GL12928-PA 3..163 1..156 363 64.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11740-PA 164 GA11740-PA 3..163 1..156 362 63.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22700-PA 155 GM22700-PA 1..155 3..157 651 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18725-PA 95 GD18725-PA 1..72 3..74 349 94.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19482-PA 146 GJ19482-PA 1..102 3..103 279 64.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16342-PA 158 GK16342-PA 23..157 22..156 233 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17348-PA 155 GE17348-PA 1..155 3..157 642 90.3 Plus

IP04020.hyp Sequence

Translation from 0 to 473

> IP04020.hyp
ENMSNFNRILIVIVIGLALVHFSAVDAQAGTVHWNNGNAAGVGVYSSAQS
GGMHPPGSLSGQDPQFSYGYAGIDSRGTYGGAGGNGAYYVSGTDEHGRPF
SYNNQVGHPGQPGYMGVRPDPNYPGTYGYQNGGAIIGSSVGVTVTIALGL
ALGGMRF*

IP04020.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:21:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG12655-PA 155 CG12655-PA 1..155 3..157 834 100 Plus