Clone IP04021 Report

Search the DGRC for IP04021

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:40
Well:21
Vector:pOT2
Associated Gene/TranscriptVhaM9.7-a-RB
Protein status:IP04021.pep: gold
Preliminary Size:440
Sequenced Size:689

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1268 2005-01-01 Successful iPCR screen
CG1268 2008-04-29 Release 5.5 accounting
CG1268 2008-08-15 Release 5.9 accounting
CG1268 2008-12-18 5.12 accounting

Clone Sequence Records

IP04021.complete Sequence

689 bp (689 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023045.1

> IP04021.complete
AAAAAAACGCCAAAAAAATGGGTGCCGCTTTCTTTCCCGTGCTGTTTTTC
ACCGCCTTGTGGGGCGGTGTGGGCATCGCCATGCCCATAATGACCCCCAA
AGGACCTCACCAGAATCTGATCCGCTGCATCCTGATGCTGACCGCCGCCT
GCTGCTGGCTCTTCTGGCTATGTTGCTACATGGCCCAAATGAATCCCTTG
ATCGGGCCCAAACTAAAGCGCGATGTGGTGGCCATGATTGGAAGGTCCTG
GAACAACCCAATTGTGGCTGGTTAGGAAAATAGAGTGACTGCTAACTAAA
TTATTCTGCAATAATCGTCACATTAGCTGTTTGTTTTACGTTGTAAATAA
GAAGTAAAAATATCAAGTGTTCTGTTAACTTCGAATTGTTTAAATATCAG
ATATTCAATAATAAATTAAATATTTAGATTGCCTTGTAAATAAAATCTAT
AGGCATCAACTAGTACATCTGCAGAATACTATTATTGTTTCAAACCAAAT
ATTCTTTCTACCAATATAAATTGTATAAATGAAGACAGTTTGAATAATAG
GTCTATTTAATTTTTTGAATAATTTAAGTTAAATTAATATTCTTTAGTTA
ATTAATGGCTACCACACAGTTATGCTGAATAAATTCCAAAAACAAGAAAG
TATTTTGACATTCCAAACAAAAAAAAAAAAAAAAAAAAA

IP04021.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG1268-RB 707 CG1268-RB 40..707 1..668 3340 100 Plus
CG1268-RC 713 CG1268-RC 54..713 9..668 3300 100 Plus
CG1268-RA 440 CG1268-RA 12..440 9..437 2145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4262191..4262850 9..668 3300 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4262805..4263469 9..673 3325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4262805..4263469 9..673 3325 100 Plus
Blast to na_te.dros performed 2019-03-16 17:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 3076..3140 377..441 126 69.7 Plus
GATE 8507 GATE DME010298 8507bp Derived from AJ010298 (e1315889) (Rel. 56, Last updated, Version 1). 8165..8210 134..179 113 71.7 Plus
Dbuz\Newton 1510 Dbuz\Newton NEWTON 1510bp 607..910 563..259 111 53.9 Minus

IP04021.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:39:09 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4262191..4262735 9..553 100 == Plus
chr3L 4262789..4262850 607..668 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:32 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
CG1268-RC 1..258 18..275 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:43 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RC 1..258 18..275 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:58:42 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RB 1..258 18..275 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:33 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
CG1268-RC 1..258 18..275 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:03:09 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RB 1..258 18..275 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:25:32 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
CG1268-RB 40..707 1..668 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:43 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RB 40..707 1..668 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:58:42 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RC 51..710 9..668 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:33 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
CG1268-RB 40..707 1..668 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:03:09 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
VhaM9.7-a-RC 51..710 9..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:39:09 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4262805..4263464 9..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:39:09 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4262805..4263464 9..668 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:39:09 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4262805..4263464 9..668 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:58:42 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4262805..4263464 9..668 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:07 Download gff for IP04021.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4262805..4263464 9..668 100   Plus

IP04021.pep Sequence

Translation from 2 to 274

> IP04021.pep
KNAKKMGAAFFPVLFFTALWGGVGIAMPIMTPKGPHQNLIRCILMLTAAC
CWLFWLCCYMAQMNPLIGPKLKRDVVAMIGRSWNNPIVAG*

IP04021.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20098-PA 85 GF20098-PA 1..85 6..90 411 90.6 Plus
Dana\GF20059-PA 83 GF20059-PA 3..82 9..88 254 52.5 Plus
Dana\GF23725-PA 89 GF23725-PA 1..81 6..87 215 47.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15212-PA 85 GG15212-PA 1..85 6..90 440 100 Plus
Dere\GG14211-PA 84 GG14211-PA 2..84 8..90 254 51.8 Plus
Dere\GG16199-PA 89 GG16199-PA 9..81 14..87 206 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:06:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15937-PA 85 GH15937-PA 1..85 6..90 383 83.5 Plus
Dgri\GH15548-PA 92 GH15548-PA 1..82 6..87 309 65.9 Plus
Dgri\GH14789-PA 89 GH14789-PA 1..81 6..87 207 45.1 Plus
Dgri\GH19550-PA 88 GH19550-PA 10..84 16..90 142 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
VhaM9.7-a-PC 85 CG1268-PC 1..85 6..90 475 100 Plus
VhaM9.7-a-PB 85 CG1268-PB 1..85 6..90 475 100 Plus
VhaM9.7-c-PA 84 CG11589-PA 4..84 10..90 264 53.1 Plus
VhaM9.7-b-PB 89 CG7625-PB 9..81 14..87 226 50 Plus
VhaM9.7-b-PA 89 CG7625-PA 9..81 14..87 226 50 Plus
VhaM9.7-d-PA 88 CG14909-PA 6..82 9..88 133 31.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16589-PA 85 GI16589-PA 1..85 6..90 401 87.1 Plus
Dmoj\GI16823-PA 85 GI16823-PA 1..85 6..90 311 67.1 Plus
Dmoj\GI21410-PA 85 GI21410-PA 1..85 6..90 311 67.1 Plus
Dmoj\Tes122-PA 89 GI11843-PA 1..81 6..87 210 46.3 Plus
Dmoj\GI23846-PA 88 GI23846-PA 4..79 10..85 146 32.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:06:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12843-PA 85 GL12843-PA 1..85 6..90 410 92.9 Plus
Dper\GL12731-PA 84 GL12731-PA 7..84 13..90 261 53.8 Plus
Dper\GL11891-PA 90 GL11891-PA 6..82 10..87 210 48.7 Plus
Dper\GL24534-PA 88 GL24534-PA 10..84 16..90 138 34.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11753-PA 85 GA11753-PA 1..85 6..90 410 92.9 Plus
Dpse\GA11084-PA 84 GA11084-PA 7..84 13..90 261 53.8 Plus
Dpse\GA20488-PA 90 GA20488-PA 6..82 10..87 210 48.7 Plus
Dpse\GA13345-PA 88 GA13345-PA 10..84 16..90 139 34.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14641-PA 85 GM14641-PA 1..85 6..90 440 100 Plus
Dsec\GM14003-PA 84 GM14003-PA 2..84 8..90 251 51.8 Plus
Dsec\GM22381-PA 89 GM22381-PA 9..81 14..87 206 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13283-PA 84 GD13283-PA 7..84 13..90 244 53.8 Plus
Dsim\GD14971-PA 89 GD14971-PA 9..81 14..87 206 50 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:06:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12841-PA 85 GJ12841-PA 1..85 6..90 387 84.7 Plus
Dvir\GJ12571-PA 85 GJ12571-PA 1..85 6..90 305 64.7 Plus
Dvir\GJ13542-PA 89 GJ13542-PA 1..81 6..87 215 47.6 Plus
Dvir\GJ10560-PA 88 GJ10560-PA 7..75 13..80 134 39.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:06:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19005-PA 85 GK19005-PA 1..85 6..90 395 84.7 Plus
Dwil\GK17834-PA 89 GK17834-PA 1..81 6..87 215 48.8 Plus
Dwil\GK18963-PA 88 GK18963-PA 8..82 14..88 129 32 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21432-PA 85 GE21432-PA 1..85 6..90 440 100 Plus
Dyak\GE20639-PA 84 GE20639-PA 7..84 13..90 248 53.8 Plus
Dyak\GE19771-PA 89 GE19771-PA 9..81 14..87 206 50 Plus
Dyak\GE19768-PA 89 GE19768-PA 9..81 14..87 206 50 Plus

IP04021.hyp Sequence

Translation from 10 to 282

> IP04021.hyp
QKNGCRFLSRAVFHRLVGRCGHRHAHNDPQRTSPESDPLHPDADRRLLLA
LLAMLLHGPNESLDRAQTKARCGGHDWKVLEQPNCGWLGK*
Sequence IP04021.hyp has no blast hits.