Clone IP04044 Report

Search the DGRC for IP04044

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:40
Well:44
Vector:pOT2
Associated Gene/TranscriptCG13239-RA
Protein status:IP04044.pep: validated not full length
Preliminary Size:459
Sequenced Size:728

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13239 2005-01-01 Successful iPCR screen
CG13239 2008-04-29 Release 5.5 accounting
CG13239 2008-08-15 Release 5.9 accounting
CG13239 2008-12-18 5.12 accounting

Clone Sequence Records

IP04044.complete Sequence

728 bp (728 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023028

> IP04044.complete
CGCTCAGCTCGACTGTTGTCTGTCTTCTCGCCGGTTTGCTTCTCCTCAGT
CTCGCGCGGGCAGATGTGGGCGTGGCCACGCAGCGTCTTCGCCCAGCGGA
TCAGCAGAAATCGGCCCTGTATCCAGCAGCCGGCTTTAAGCCCTCTAGAC
AGTTTGGCCTTCCGGCAACCGACCAGCAACCGAAATCCGCTCGCCTTGTG
GCCAACAGTGAAGCGCAGGAGGATCTCGACGACGCCGCCGAGGAGGTGGA
GGTGACGCAACCAAAGACAGTTTCTGTGCCACGCCTAGTTCCTGCTCCAG
GGCCAGCATTACCGGTAACTCCCACCATCGCATACTATCCGGCCGAAGCC
GTGGGATTCGTCCAGCCATCAACTTTCGCCAAGTTCATCGGTGGCCCACA
GCAGGCTGCACCATATGTAGCTGCGTCGCAGTACTACCAAGCCTATTTTG
GATAGACACGAACAGATACAGATACAGATAAAGATACAGAATACATTAAA
AAAGGATTTATAACGTCTTAGTTAACTTATATAACTTTAATTGTTAAACC
TGACCTGTTCCACACAGACAGTAATCCCATACATATGTCCAAACATACAT
ATGTCCATCTGTCCGTATGAACGTCGACATATCTGAAATTATAAGAGCGA
TAAGATTCAGGTTGTTTCAGAGTAATAACAATAAATATACAATATACAAT
ATACAATAAAAAAAAAAAAAAAAAAAAA

IP04044.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13239-RA 704 CG13239-RA 5..704 1..700 3500 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22849707..22850413 1..707 3535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22860791..22861498 1..708 3540 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22853891..22854598 1..708 3540 100 Plus
Blast to na_te.dros performed 2019-03-16 03:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
INE-1 611 INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). 123..185 601..663 198 79.4 Plus
Dbuz\ISBu2 726 Dbuz\ISBu2 ISBU2 726bp 145..211 586..652 173 73.1 Plus
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 1211..1294 659..580 123 63.1 Minus

IP04044.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed on 2019-03-16 03:34:04 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:41 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..459 1..455 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:30 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..459 1..455 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:59:30 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..459 1..455 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:20 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..459 1..455 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:08:22 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..459 1..455 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:25:15 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..459 1..455 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:30 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..704 1..700 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:59:30 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..704 1..700 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:20 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..459 1..455 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:08:22 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
CG13239-RA 5..704 1..700 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:04 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22860791..22861497 1..707 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:04 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22860791..22861497 1..707 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:34:04 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22860791..22861497 1..707 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:59:30 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22853891..22854597 1..707 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:53 Download gff for IP04044.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22853891..22854597 1..707 100   Plus

IP04044.pep Sequence

Translation from 2 to 454

> IP04044.pep
LSSTVVCLLAGLLLLSLARADVGVATQRLRPADQQKSALYPAAGFKPSRQ
FGLPATDQQPKSARLVANSEAQEDLDDAAEEVEVTQPKTVSVPRLVPAPG
PALPVTPTIAYYPAEAVGFVQPSTFAKFIGGPQQAAPYVAASQYYQAYFG
*

IP04044.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16280-PA 145 GG16280-PA 3..145 1..150 559 84.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16770-PA 194 GH16770-PA 103..194 59..150 253 60.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13239-PA 152 CG13239-PA 3..152 1..150 756 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13431-PA 223 GI13431-PA 129..198 59..129 169 59.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24969-PA 188 GL24969-PA 3..188 1..150 352 53.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12145-PA 186 GA12145-PA 3..186 1..150 360 54.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22473-PA 152 GM22473-PA 3..152 1..150 624 94 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:01:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15054-PA 152 GD15054-PA 3..152 1..150 717 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11793-PA 208 GJ11793-PA 114..183 59..129 152 58.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20392-PA 160 GK20392-PA 3..160 1..150 211 43.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:01:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22641-PA 149 GE22641-PA 3..149 1..150 620 84.7 Plus

IP04044.hyp Sequence

Translation from 2 to 454

> IP04044.hyp
LSSTVVCLLAGLLLLSLARADVGVATQRLRPADQQKSALYPAAGFKPSRQ
FGLPATDQQPKSARLVANSEAQEDLDDAAEEVEVTQPKTVSVPRLVPAPG
PALPVTPTIAYYPAEAVGFVQPSTFAKFIGGPQQAAPYVAASQYYQAYFG
*

IP04044.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG13239-PA 152 CG13239-PA 3..152 1..150 756 100 Plus