BDGP Sequence Production Resources |
Search the DGRC for IP04044
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 40 |
Well: | 44 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13239-RA |
Protein status: | IP04044.pep: validated not full length |
Preliminary Size: | 459 |
Sequenced Size: | 728 |
Gene | Date | Evidence |
---|---|---|
CG13239 | 2005-01-01 | Successful iPCR screen |
CG13239 | 2008-04-29 | Release 5.5 accounting |
CG13239 | 2008-08-15 | Release 5.9 accounting |
CG13239 | 2008-12-18 | 5.12 accounting |
728 bp (728 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023028
> IP04044.complete CGCTCAGCTCGACTGTTGTCTGTCTTCTCGCCGGTTTGCTTCTCCTCAGT CTCGCGCGGGCAGATGTGGGCGTGGCCACGCAGCGTCTTCGCCCAGCGGA TCAGCAGAAATCGGCCCTGTATCCAGCAGCCGGCTTTAAGCCCTCTAGAC AGTTTGGCCTTCCGGCAACCGACCAGCAACCGAAATCCGCTCGCCTTGTG GCCAACAGTGAAGCGCAGGAGGATCTCGACGACGCCGCCGAGGAGGTGGA GGTGACGCAACCAAAGACAGTTTCTGTGCCACGCCTAGTTCCTGCTCCAG GGCCAGCATTACCGGTAACTCCCACCATCGCATACTATCCGGCCGAAGCC GTGGGATTCGTCCAGCCATCAACTTTCGCCAAGTTCATCGGTGGCCCACA GCAGGCTGCACCATATGTAGCTGCGTCGCAGTACTACCAAGCCTATTTTG GATAGACACGAACAGATACAGATACAGATAAAGATACAGAATACATTAAA AAAGGATTTATAACGTCTTAGTTAACTTATATAACTTTAATTGTTAAACC TGACCTGTTCCACACAGACAGTAATCCCATACATATGTCCAAACATACAT ATGTCCATCTGTCCGTATGAACGTCGACATATCTGAAATTATAAGAGCGA TAAGATTCAGGTTGTTTCAGAGTAATAACAATAAATATACAATATACAAT ATACAATAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13239-RA | 704 | CG13239-RA | 5..704 | 1..700 | 3500 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 22849707..22850413 | 1..707 | 3535 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 22860791..22861498 | 1..708 | 3540 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 22853891..22854598 | 1..708 | 3540 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
INE-1 | 611 | INE-1 INE1 611bp Derived from U66884 (e1371475) (Rel. 52, Last updated, Version 6). | 123..185 | 601..663 | 198 | 79.4 | Plus |
Dbuz\ISBu2 | 726 | Dbuz\ISBu2 ISBU2 726bp | 145..211 | 586..652 | 173 | 73.1 | Plus |
Dbuz\INE-1 | 1467 | Dbuz\INE-1 ISBU1 1467bp | 1211..1294 | 659..580 | 123 | 63.1 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..459 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..459 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..459 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..459 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..459 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..459 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..704 | 1..700 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..704 | 1..700 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..459 | 1..455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13239-RA | 5..704 | 1..700 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22860791..22861497 | 1..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22860791..22861497 | 1..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22860791..22861497 | 1..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 22853891..22854597 | 1..707 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22853891..22854597 | 1..707 | 100 | Plus |
Translation from 2 to 454
> IP04044.pep LSSTVVCLLAGLLLLSLARADVGVATQRLRPADQQKSALYPAAGFKPSRQ FGLPATDQQPKSARLVANSEAQEDLDDAAEEVEVTQPKTVSVPRLVPAPG PALPVTPTIAYYPAEAVGFVQPSTFAKFIGGPQQAAPYVAASQYYQAYFG *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16280-PA | 145 | GG16280-PA | 3..145 | 1..150 | 559 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16770-PA | 194 | GH16770-PA | 103..194 | 59..150 | 253 | 60.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13239-PA | 152 | CG13239-PA | 3..152 | 1..150 | 756 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13431-PA | 223 | GI13431-PA | 129..198 | 59..129 | 169 | 59.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24969-PA | 188 | GL24969-PA | 3..188 | 1..150 | 352 | 53.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12145-PA | 186 | GA12145-PA | 3..186 | 1..150 | 360 | 54.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22473-PA | 152 | GM22473-PA | 3..152 | 1..150 | 624 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15054-PA | 152 | GD15054-PA | 3..152 | 1..150 | 717 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11793-PA | 208 | GJ11793-PA | 114..183 | 59..129 | 152 | 58.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20392-PA | 160 | GK20392-PA | 3..160 | 1..150 | 211 | 43.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE22641-PA | 149 | GE22641-PA | 3..149 | 1..150 | 620 | 84.7 | Plus |
Translation from 2 to 454
> IP04044.hyp LSSTVVCLLAGLLLLSLARADVGVATQRLRPADQQKSALYPAAGFKPSRQ FGLPATDQQPKSARLVANSEAQEDLDDAAEEVEVTQPKTVSVPRLVPAPG PALPVTPTIAYYPAEAVGFVQPSTFAKFIGGPQQAAPYVAASQYYQAYFG *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13239-PA | 152 | CG13239-PA | 3..152 | 1..150 | 756 | 100 | Plus |