Clone IP04046 Report

Search the DGRC for IP04046

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:40
Well:46
Vector:pOT2
Associated Gene/TranscriptCG13323-RA
Protein status:IP04046.pep: gold
Preliminary Size:411
Sequenced Size:524

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13323 2005-01-01 Successful iPCR screen
CG13323 2008-04-29 Release 5.5 accounting
CG13323 2008-08-15 Release 5.9 accounting
CG13323 2008-12-18 5.12 accounting

Clone Sequence Records

IP04046.complete Sequence

524 bp (524 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023029

> IP04046.complete
AACGTCGAAACGAAACATTCAACATGCGTCTTCTGCTCATCCTCTCAGTT
GTCCTGGCCGTGATCCTTGGCTGCCACGCCTACGGCGCCACCTGGGGGCG
TCGCAATAACAACGACTACCTGCTGTCCCGCACCACGGAAGTCCGCAATC
CGATCAAGAACAACTACTGGAACGTGAACGTGAACTATCCCGCCGGATTC
TACAACATCTCCGCCGTGATCGTCTACGACAACTTTAAGAACAACTCCGG
CGCATCTCCTAGCCTCTATTCCGGCGGTCCGGGCTATCGCTTCGCCACCG
TGAATCTTCGTGGTCAGGTGAACCGCGGAATCAACTCCACCGTCGAGATC
TGGGGTCGTTAAGTGATCAAACGAATCTGTTATAACCGACTGAAAGTCGC
TGGGATATCAACTGAAACATGTTTCTTACGCAACTCAAAGCTAAATCATC
AATCTTAACAAATAAAAGAATACAGTAAAATACATACATATATATGGCAG
TATTAAAAAAAAAAAAAAAAAAAA

IP04046.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-RA 556 CG13323-RA 50..556 1..507 2520 99.8 Plus
CG13324-RA 496 CG13324-RA 104..364 108..368 1035 93.1 Plus
CG13324-RA 496 CG13324-RA 13..96 17..100 390 97.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8934071..8934574 504..1 2505 99.8 Minus
chr2R 21145070 chr2R 8936609..8936960 368..17 1370 92.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13046733..13047239 507..1 2520 99.8 Minus
2R 25286936 2R 13049274..13049625 368..17 1370 92.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13047932..13048438 507..1 2520 99.8 Minus
2R 25260384 2R 13050473..13050733 368..108 1035 93.1 Minus
2R 25260384 2R 13050741..13050824 100..17 390 97.6 Minus
Blast to na_te.dros performed on 2019-03-16 02:31:48 has no hits.

IP04046.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:32:43 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8934071..8934574 1..504 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:42 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:31 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:00:36 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:21 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:14:17 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 1..339 24..362 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:25:16 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 50..553 1..504 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:31 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 50..553 1..504 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:00:36 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 18..521 1..504 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:21 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 50..553 1..504 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:14:17 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
CG13323-RA 18..521 1..504 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:43 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13046736..13047239 1..504 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:43 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13046736..13047239 1..504 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:43 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13046736..13047239 1..504 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:00:36 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8934241..8934744 1..504 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:54 Download gff for IP04046.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13047935..13048438 1..504 99   Minus

IP04046.hyp Sequence

Translation from 2 to 361

> IP04046.hyp
RRNETFNMRLLLILSVVLAVILGCHAYGATWGRRNNNDYLLSRTTEVRNP
IKNNYWNVNVNYPAGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATV
NLRGQVNRGINSTVEIWGR*

IP04046.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-PB 112 CG13323-PB 1..112 8..119 598 100 Plus
CG13323-PA 112 CG13323-PA 1..112 8..119 598 100 Plus
CG13324-PA 112 CG13324-PA 1..112 8..119 562 94.6 Plus
CG31789-PC 117 CG31789-PC 4..114 8..117 145 32.5 Plus
CG31789-PB 117 CG31789-PB 4..114 8..117 145 32.5 Plus

IP04046.pep Sequence

Translation from 23 to 361

> IP04046.pep
MRLLLILSVVLAVILGCHAYGATWGRRNNNDYLLSRTTEVRNPIKNNYWN
VNVNYPAGFYNISAVIVYDNFKNNSGASPSLYSGGPGYRFATVNLRGQVN
RGINSTVEIWGR*

IP04046.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11989-PA 115 GF11989-PA 1..115 1..112 440 73.9 Plus
Dana\GF15061-PA 116 GF15061-PA 1..114 1..110 133 32.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22531-PA 112 GG22531-PA 1..112 1..112 540 93.8 Plus
Dere\GG22532-PA 112 GG22532-PA 1..112 1..112 478 94.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17985-PA 116 GH17985-PA 9..116 9..112 361 63 Plus
Dgri\GH21597-PA 116 GH21597-PA 1..116 1..112 358 59.5 Plus
Dgri\GH21596-PA 116 GH21596-PA 9..116 9..112 350 61.1 Plus
Dgri\GH21729-PA 120 GH21729-PA 26..120 22..112 132 32.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG13323-PB 112 CG13323-PB 1..112 1..112 598 100 Plus
CG13323-PA 112 CG13323-PA 1..112 1..112 598 100 Plus
CG13324-PA 112 CG13324-PA 1..112 1..112 562 94.6 Plus
CG31789-PC 117 CG31789-PC 4..114 1..110 145 32.5 Plus
CG31789-PB 117 CG31789-PB 4..114 1..110 145 32.5 Plus
CG31789-PA 117 CG31789-PA 4..114 1..110 145 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19567-PA 118 GI19567-PA 1..116 1..112 336 56.9 Plus
Dmoj\GI18871-PA 119 GI18871-PA 10..119 3..112 139 32.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:02:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10591-PA 116 GL10591-PA 1..116 1..112 400 63.8 Plus
Dper\GL10590-PA 116 GL10590-PA 1..116 1..112 364 57.8 Plus
Dper\GL16235-PA 120 GL16235-PA 6..120 2..112 146 32.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12205-PA 116 GA12205-PA 1..116 1..112 400 63.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20317-PA 112 GM20317-PA 1..112 1..112 557 97.3 Plus
Dsec\GM20316-PA 112 GM20316-PA 1..112 1..112 407 92.9 Plus
Dsec\GM17281-PA 117 GM17281-PA 1..114 1..110 141 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25795-PA 112 GD25795-PA 1..112 1..112 561 98.2 Plus
Dsim\GD25794-PA 112 GD25794-PA 1..112 1..112 532 92.9 Plus
Dsim\GD24143-PA 117 GD24143-PA 1..114 1..110 139 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21142-PA 116 GJ21142-PA 1..116 1..112 378 59.5 Plus
Dvir\GJ21904-PA 118 GJ21904-PA 10..118 3..112 140 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21639-PA 116 GK21639-PA 1..116 1..112 403 68.1 Plus
Dwil\GK10198-PA 115 GK10198-PA 1..115 1..111 168 33.9 Plus
Dwil\GK21944-PA 112 GK21944-PA 1..112 1..112 144 32.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13403-PA 112 GE13403-PA 1..112 1..112 420 95.5 Plus
Dyak\GE13402-PA 112 GE13402-PA 1..112 1..112 416 93.8 Plus
Dyak\GE14474-PA 117 GE14474-PA 1..114 1..110 153 33.3 Plus
Dyak\GE13194-PA 117 GE13194-PA 1..114 1..110 153 33.3 Plus