Clone IP04051 Report

Search the DGRC for IP04051

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:40
Well:51
Vector:pOT2
Associated Gene/TranscriptCG13473-RA
Protein status:IP04051.pep: gold
Preliminary Size:420
Sequenced Size:593

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13473 2005-01-01 Successful iPCR screen
CG13473 2008-04-29 Release 5.5 accounting
CG13473 2008-08-15 Release 5.9 accounting
CG13473 2008-12-18 5.12 accounting

Clone Sequence Records

IP04051.complete Sequence

593 bp (593 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023024

> IP04051.complete
CAAAAACTCTAAATTTTATGTGTGTAAAATTGTGGGTAACATTTTGAAAC
AAGTTTCGAAAACGACGGTTTCCGATGGCTGCCATGCAGAAGAAGGTCAT
CATTGTGGATTCGAAGAGTTACTTTGATAAGCTCATCGATGATGCGGGAA
CCAACAAATACGTACTTGTCGAGTTCTTCGCCACCTGGTGTGGTCCTTGC
GCGATGATTGGTCCCCGCTTGGAGCAACTGGCATCGGATTACTTCGGACG
GATGTTGGTCCTTAAGATTGACGTTGATGAGAACGAAGATCTGGCCGTTC
AGTACGAAGTCAACAGCATGCCCACATTTCTGATCATCAAAAACCGAGTG
ACACTAATCCAGTTCGTGGGCGGCAATGTCGAAAGGGTCGTCAGCACGGT
GGAGAAGTTTGTGGGCAAGGTGGAGGACTCCAAGGAGCACAAGTCGAAAG
AGGGAGGTGCTAGTTCAGCTACCGTGCCGAAATTGGAACGCTAAAACATT
TACATCCTTGGGGGTCTTTTAGTCTGGTTATCATCATGCAGTATTGATCG
AAATTAAAGTGTGTGAAAAAGTTTAAAAAAAAAAAAAAAAAAA

IP04051.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13473-RA 420 CG13473-RA 1..420 75..494 2100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:15:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14718908..14719481 1..574 2855 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:14:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14728766..14729339 1..574 2870 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14721866..14722439 1..574 2870 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:14:58 has no hits.

IP04051.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:15:38 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14718908..14719481 1..574 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:44 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 1..420 75..494 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:32 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 1..420 75..494 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:39:27 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 1..420 75..494 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:22 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 1..420 75..494 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:15:32 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 1..420 75..494 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:25:18 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 1..420 75..494 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:32 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 7..580 1..574 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:39:27 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 7..580 1..574 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:22 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 1..420 75..494 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:15:32 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
CG13473-RA 7..580 1..574 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:38 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14728766..14729339 1..574 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:38 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14728766..14729339 1..574 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:15:38 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14728766..14729339 1..574 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:39:27 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14721866..14722439 1..574 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:56 Download gff for IP04051.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14721866..14722439 1..574 100   Plus

IP04051.pep Sequence

Translation from 74 to 493

> IP04051.pep
MAAMQKKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLE
QLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGG
NVERVVSTVEKFVGKVEDSKEHKSKEGGASSATVPKLER*

IP04051.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:02:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24615-PA 119 GF24615-PA 1..119 20..137 437 67.2 Plus
Dana\TrxT-PA 177 GF20950-PA 2..130 8..130 275 43.8 Plus
Dana\Trx-2-PA 106 GF22780-PA 5..98 11..105 251 48.4 Plus
Dana\GF24914-PA 143 GF24914-PA 27..123 1..99 188 32.3 Plus
Dana\GF23991-PA 287 GF23991-PA 3..107 8..114 185 33.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15694-PA 135 GG15694-PA 1..132 1..139 615 84.9 Plus
Dere\TrxT-PA 149 GG18503-PA 2..107 8..114 261 43.9 Plus
Dere\Trx-2-PA 106 GG10043-PA 18..98 25..105 233 46.9 Plus
Dere\dhd-PA 107 GG18749-PA 15..105 23..113 196 37.4 Plus
Dere\GG15284-PA 287 GG15284-PA 3..103 8..110 182 35 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:02:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14756-PA 133 GH14756-PA 12..118 6..113 367 61.1 Plus
Dgri\Trx-2-PA 106 GH10676-PA 15..106 21..113 267 49.5 Plus
Dgri\TrxT-PA 166 GH24365-PA 2..111 8..118 241 37.8 Plus
Dgri\GH15527-PA 287 GH15527-PA 3..107 8..114 183 32.7 Plus
Dgri\dhd-PA 106 GH24609-PA 4..103 11..111 178 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13473-PA 139 CG13473-PA 1..139 1..139 705 100 Plus
TrxT-PB 157 CG3315-PB 20..111 27..118 253 48.9 Plus
TrxT-PA 157 CG3315-PA 20..111 27..118 253 48.9 Plus
Trx-2-PA 106 CG31884-PA 19..103 26..110 239 45.9 Plus
Trx-2-PB 106 CG31884-PB 19..103 26..110 239 45.9 Plus
dhd-PB 107 CG4193-PB 15..105 23..113 193 37.4 Plus
dhd-PA 107 CG4193-PA 15..105 23..113 193 37.4 Plus
CG8993-PA 142 CG8993-PA 27..123 1..99 186 32.3 Plus
Txl-PA 287 CG5495-PA 3..107 8..114 173 32.7 Plus
CG8517-PA 145 CG8517-PA 28..120 5..99 170 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:02:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11498-PA 162 GI11498-PA 12..120 6..115 383 62.7 Plus
Dmoj\TrxT-PA 165 GI11058-PA 2..139 8..137 286 40.3 Plus
Dmoj\Trx-2-PA 106 GI11084-PA 2..106 8..113 278 47.2 Plus
Dmoj\GI14472-PA 106 GI14472-PA 15..103 23..111 182 37.1 Plus
Dmoj\dhd-PA 106 GI11071-PA 15..104 23..112 180 37.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24554-PA 141 GL24554-PA 1..131 1..132 452 64.4 Plus
Dper\TrxT-PA 167 GL14330-PA 2..107 8..114 285 47.7 Plus
Dper\dhd-PA 106 GL14288-PA 15..105 23..113 196 37.4 Plus
Dper\GL24652-PA 143 GL24652-PA 27..123 1..99 193 33.3 Plus
Dper\GL16306-PA 287 GL16306-PA 3..107 8..114 183 33.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12311-PA 141 GA12311-PA 1..131 1..132 456 64.4 Plus
Dpse\TrxT-PA 167 GA17324-PA 2..107 8..114 291 48.6 Plus
Dpse\Trx-2-PA 106 GA16546-PA 5..98 11..105 252 46.3 Plus
Dpse\dhd-PA 106 GA18018-PA 15..105 23..113 196 37.4 Plus
Dpse\GA21460-PA 143 GA21460-PA 27..123 1..99 193 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25478-PA 139 GM25478-PA 1..139 1..137 688 95.7 Plus
Dsec\TrxT-PA 172 GM12651-PA 2..107 8..114 254 44.9 Plus
Dsec\Trx-2-PA 106 GM17580-PA 18..98 25..105 248 49.4 Plus
Dsec\dhd-PA 107 GM12398-PA 15..105 23..113 200 37.4 Plus
Dsec\GM14718-PA 287 GM14718-PA 3..107 8..114 181 32.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14500-PA 139 GD14500-PA 1..139 1..137 688 95.7 Plus
Dsim\Trx-2-PA 106 GD23618-PA 18..98 25..105 248 49.4 Plus
Dsim\GD11480-PA 145 GD11480-PA 28..120 5..99 176 31.6 Plus
Dsim\GD13682-PA 142 GD13682-PA 27..123 1..99 158 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13693-PA 162 GJ13693-PA 12..141 6..139 381 55.2 Plus
Dvir\TrxT-PA 163 GJ16575-PA 2..138 8..139 289 39.1 Plus
Dvir\Trx-2-PA 106 GJ18315-PA 11..106 17..113 278 49.5 Plus
Dvir\dhd-PA 106 GJ16851-PA 15..103 23..111 200 38.2 Plus
Dvir\GJ12550-PA 287 GJ12550-PA 3..107 8..114 191 34.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:02:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10532-PA 176 GK10532-PA 1..115 1..115 436 69 Plus
Dwil\TrxT-PA 174 GK25104-PA 2..107 8..114 290 47.7 Plus
Dwil\Trx-2-PA 106 GK23868-PA 5..104 11..111 257 46.5 Plus
Dwil\GK12639-PA 141 GK12639-PA 25..121 1..99 198 34.3 Plus
Dwil\dhd1-PA 108 GK25840-PA 17..106 23..112 190 37.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:02:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22025-PA 132 GE22025-PA 1..126 1..126 624 92.9 Plus
Dyak\TrxT-PA 157 GE16820-PA 2..107 8..114 261 45.8 Plus
Dyak\Trx-2-PA 106 GE18857-PA 18..98 25..105 201 48.1 Plus
Dyak\dhd-PA 107 GE16391-PA 10..105 17..113 197 38.1 Plus
Dyak\GE21506-PA 287 GE21506-PA 3..107 8..114 186 33.6 Plus

IP04051.hyp Sequence

Translation from 74 to 493

> IP04051.hyp
MAAMQKKVIIVDSKSYFDKLIDDAGTNKYVLVEFFATWCGPCAMIGPRLE
QLASDYFGRMLVLKIDVDENEDLAVQYEVNSMPTFLIIKNRVTLIQFVGG
NVERVVSTVEKFVGKVEDSKEHKSKEGGASSATVPKLER*

IP04051.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG13473-PA 139 CG13473-PA 1..139 1..139 705 100 Plus
TrxT-PB 157 CG3315-PB 20..111 27..118 253 48.9 Plus
TrxT-PA 157 CG3315-PA 20..111 27..118 253 48.9 Plus
Trx-2-PA 106 CG31884-PA 19..103 26..110 239 45.9 Plus
Trx-2-PB 106 CG31884-PB 19..103 26..110 239 45.9 Plus