Clone IP04067 Report

Search the DGRC for IP04067

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:40
Well:67
Vector:pOT2
Associated Gene/TranscriptCG13807-RA
Protein status:IP04067.pep: gold
Preliminary Size:513
Sequenced Size:621

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13807 2005-01-01 Successful iPCR screen
CG13807 2008-04-29 Release 5.5 accounting
CG13807 2008-08-15 Release 5.9 accounting
CG13807 2008-12-18 5.12 accounting

Clone Sequence Records

IP04067.complete Sequence

621 bp (621 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023020

> IP04067.complete
AAACAATGGTGGATCCCAACCGAAAGATAAACCGTCTGGTCGAAAGGGAC
CTGAACTTCCTGGAGTCCTGCGAGCTTGAGTTCGCAGACCGCTTCACTGA
CGACGACCCAGAGTTCATGGCGCACTGCAGCAAGCCTGTGCCGGAGCCGC
CAATTGTGGAGAACTGGATGGGAGGTGGCGGAGGAGGAGGCGGCTTCCAG
GGCGGAGGAGGCGGTGGTCATCCCTACCACAATCGCTACAACGGACATCG
CAGAGGAGGCGGCGACAGGGGCTGGCAGCGACGAGGAGGAGCTGGCTACC
ACAACAACCAGGACAGGGGATTCAGGGACAACCGGCGCAACAACAGATAC
GATCACATCGATCGCCGGAATCGGTACGAAGGAGGCGGAGGGTCCGGAGG
ATCTGGAGGCTACAAGCGCTCCCATGATCATAACCAGAGAAATGATACTC
CCAATAACGAACCACCCATGAAGGTCAGACGCGACTATGGAAACTTTGTG
CCTGCATCCAAGGATTAGTTATCGAATATATCAAATAAGAATACTCTGCA
TTACATTGAAATATTCACATTGACGTTTATTTAATGGAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

IP04067.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG13807-RA 825 CG13807-RA 188..775 1..588 2940 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:31:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2262370..2262696 1..327 1635 100 Plus
chr3L 24539361 chr3L 2262757..2263017 327..587 1260 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2262968..2263294 1..327 1635 100 Plus
3L 28110227 3L 2263355..2263616 327..588 1310 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2262968..2263294 1..327 1635 100 Plus
3L 28103327 3L 2263355..2263616 327..588 1310 100 Plus
Blast to na_te.dros performed 2019-03-15 15:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
Tabor 7345 Tabor TABOR 7345bp 2682..2729 273..319 111 72.9 Plus

IP04067.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:32:18 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2262370..2262696 1..327 100 -> Plus
chr3L 2262758..2263017 328..587 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:46 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 1..513 6..518 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:35 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 1..513 6..518 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:31:56 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 1..513 6..518 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:24 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 1..513 6..518 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:09:13 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 1..513 6..518 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:25:21 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 1..513 6..518 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:35 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 50..636 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:31:56 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 50..636 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:24 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 1..513 6..518 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:09:13 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
CG13807-RA 50..636 1..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:18 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2262968..2263294 1..327 100 -> Plus
3L 2263356..2263615 328..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:18 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2262968..2263294 1..327 100 -> Plus
3L 2263356..2263615 328..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:32:18 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2262968..2263294 1..327 100 -> Plus
3L 2263356..2263615 328..587 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:31:56 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2263356..2263615 328..587 100   Plus
arm_3L 2262968..2263294 1..327 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:58 Download gff for IP04067.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2263356..2263615 328..587 100   Plus
3L 2262968..2263294 1..327 100 -> Plus

IP04067.hyp Sequence

Translation from 2 to 517

> IP04067.hyp
TMVDPNRKINRLVERDLNFLESCELEFADRFTDDDPEFMAHCSKPVPEPP
IVENWMGGGGGGGGFQGGGGGGHPYHNRYNGHRRGGGDRGWQRRGGAGYH
NNQDRGFRDNRRNNRYDHIDRRNRYEGGGGSGGSGGYKRSHDHNQRNDTP
NNEPPMKVRRDYGNFVPASKD*

IP04067.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13807-PA 170 CG13807-PA 1..170 2..171 978 100 Plus
caz-PD 355 CG3606-PD 266..324 58..144 158 47.1 Plus
caz-PC 384 CG3606-PC 295..353 58..144 158 47.1 Plus
caz-PB 399 CG3606-PB 310..368 58..144 158 47.1 Plus
CG30122-PD 1271 CG30122-PD 940..1044 57..164 154 39.1 Plus

IP04067.pep Sequence

Translation from 5 to 517

> IP04067.pep
MVDPNRKINRLVERDLNFLESCELEFADRFTDDDPEFMAHCSKPVPEPPI
VENWMGGGGGGGGFQGGGGGGHPYHNRYNGHRRGGGDRGWQRRGGAGYHN
NQDRGFRDNRRNNRYDHIDRRNRYEGGGGSGGSGGYKRSHDHNQRNDTPN
NEPPMKVRRDYGNFVPASKD*

IP04067.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24907-PA 166 GF24907-PA 1..166 1..170 381 69.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14851-PA 174 GG14851-PA 1..174 1..170 596 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15003-PA 177 GH15003-PA 1..177 1..170 336 56.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13807-PA 170 CG13807-PA 1..170 1..170 978 100 Plus
caz-PD 355 CG3606-PD 266..324 57..143 158 47.1 Plus
caz-PC 384 CG3606-PC 295..353 57..143 158 47.1 Plus
caz-PB 399 CG3606-PB 310..368 57..143 158 47.1 Plus
CG30122-PD 1271 CG30122-PD 940..1044 56..163 154 39.1 Plus
CG30122-PB 1271 CG30122-PB 940..1044 56..163 154 39.1 Plus
CG30122-PC 1272 CG30122-PC 940..1044 56..163 154 39.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13165-PA 166 GI13165-PA 1..166 1..170 379 51.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24643-PA 198 GL24643-PA 1..58 1..58 223 74.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:02:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12543-PA 198 GA12543-PA 1..58 1..58 197 74.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14476-PA 170 GM14476-PA 1..170 1..170 843 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13670-PA 148 GD13670-PA 1..148 1..170 519 82.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11939-PA 170 GJ11939-PA 1..170 1..170 365 58 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12630-PA 203 GK12630-PA 1..203 1..170 277 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:02:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20308-PA 168 GE20308-PA 1..168 1..170 608 93.5 Plus