Clone IP04093 Report

Search the DGRC for IP04093

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:40
Well:93
Vector:pOT2
Associated Gene/TranscriptCG42561-RA
Protein status:IP04093.pep: gold
Preliminary Size:513
Sequenced Size:720

Clone Sequence Records

IP04093.complete Sequence

720 bp assembled on 2011-03-18

GenBank Submission: BT126169.1

> IP04093.complete
CTGAAGTGTTTCTCGCGAAGCAGATGTGTGATTTTTTTGTATCTTCATCG
TAAAAATCAAAACTCGTTTGCTTGCTACTTAAATCAACCAGCCTTCGTTT
TGGGCTCAAAACTGACCAAGCGTTCAGATATTCAGATAGTTTTTGTTCAA
CCACAGACAGGTCATCATGTCTCGCGATTTTTTCGCGCTGTTGGCAATTT
TCATCTTCACTGCGGTCAACGCGGCACCGCAAATTTCACCAACTATCGTT
CCGCAAATCCGCACAAATGGCTTTCAACTTGAGCCCCTCAATCAAGAATA
CTTTCTCAGAATCGAACATCCGGGTGGCACTATTCGCCAGGAATCCGTGA
GCCAGAATGAAGCCGGACATCTGCAGGTTAAAGGTGTGATTAACCAGCCC
TTCGAGGATCAGGATGCCAATCTTATTGTCACCTATGAGGCTGGTCCGAA
TGGATATGTTGCCAAATACAGCTTCGGCAAGGGTCCTCCAACACCGCCTC
CTGACACACCATTATTCCTCAGTCCCGGTGCTCTGAAAACTGCAGCGGGA
TAGGATTTTGACTGAATATTTAGAAAACATTAAAACCACAACTTGCCGTA
ATTTATATTAAACCAATTCTGTATTTATAAGTAACAATAAGTAAGTTTAT
AATCACTCACTAGTTTATAGAAATCAATAAACTAGCTAGACTTTCTTAAC
TATAAAAAAAAAAAAAAAAA

IP04093.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13572255..13572650 308..703 1980 100 Plus
chr2R 21145070 chr2R 13571820..13572006 1..187 935 100 Plus
chr2R 21145070 chr2R 13572075..13572197 187..309 615 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17685153..17685554 308..709 1995 99.8 Plus
2R 25286936 2R 17684718..17684904 1..187 935 100 Plus
2R 25286936 2R 17684973..17685095 187..309 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17686352..17686753 308..709 1995 99.7 Plus
2R 25260384 2R 17685917..17686103 1..187 935 100 Plus
2R 25260384 2R 17686172..17686294 187..309 615 100 Plus
Blast to na_te.dros performed 2019-03-16 22:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 6139..6259 565..685 144 65.1 Plus

IP04093.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:33:55 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13572257..13572650 310..703 100   Plus
chr2R 13571820..13572006 1..187 100 -> Plus
chr2R 13572076..13572197 188..309 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-22 17:53:19 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 1..387 167..553 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:57:39 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 1..387 167..553 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:29:54 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 1..387 167..553 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-22 17:53:19 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 1..703 1..703 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:57:39 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 1..566 138..703 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:29:54 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
CG42561-RA 1..566 138..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:55 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17684718..17684904 1..187 100 -> Plus
2R 17684974..17685095 188..309 100 -> Plus
2R 17685155..17685548 310..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:55 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17684718..17684904 1..187 100 -> Plus
2R 17684974..17685095 188..309 100 -> Plus
2R 17685155..17685548 310..703 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:33:55 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17684718..17684904 1..187 100 -> Plus
2R 17684974..17685095 188..309 100 -> Plus
2R 17685155..17685548 310..703 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:57:39 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13572479..13572600 188..309 100 -> Plus
arm_2R 13572223..13572409 1..187 100 -> Plus
arm_2R 13572660..13573053 310..703 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:01:43 Download gff for IP04093.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17686354..17686747 310..703 100   Plus
2R 17686173..17686294 188..309 100 -> Plus
2R 17685917..17686103 1..187 100 -> Plus

IP04093.hyp Sequence

Translation from 166 to 552

> IP04093.hyp
MSRDFFALLAIFIFTAVNAAPQISPTIVPQIRTNGFQLEPLNQEYFLRIE
HPGGTIRQESVSQNEAGHLQVKGVINQPFEDQDANLIVTYEAGPNGYVAK
YSFGKGPPTPPPDTPLFLSPGALKTAAG*

IP04093.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-PA 128 CG42561-PA 1..128 1..128 669 100 Plus
CG42562-PA 126 CG42562-PA 8..126 7..128 182 43.9 Plus

IP04093.pep Sequence

Translation from 166 to 552

> IP04093.pep
MSRDFFALLAIFIFTAVNAAPQISPTIVPQIRTNGFQLEPLNQEYFLRIE
HPGGTIRQESVSQNEAGHLQVKGVINQPFEDQDANLIVTYEAGPNGYVAK
YSFGKGPPTPPPDTPLFLSPGALKTAAG*

IP04093.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 18:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11661-PA 84 GF11661-PA 4..84 48..128 270 75.3 Plus
Dana\GF11662-PA 124 GF11662-PA 8..124 7..128 184 41.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 18:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21809-PA 167 GG21809-PA 8..54 59..105 229 93.6 Plus
Dere\GG21809-PA 167 GG21809-PA 72..167 28..128 174 49.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 18:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20762-PA 123 GH20762-PA 20..123 26..128 220 48.6 Plus
Dgri\GH20763-PA 123 GH20763-PA 20..123 26..128 192 47.2 Plus
Dgri\GH14922-PA 128 GH14922-PA 56..128 54..128 154 49.3 Plus
Dgri\GH20761-PA 124 GH20761-PA 2..124 5..128 142 37.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG42561-PA 128 CG42561-PA 1..128 1..128 669 100 Plus
CG42562-PA 126 CG42562-PA 8..126 7..128 182 43.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 18:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11436-PA 120 GI11436-PA 1..120 1..128 210 44.2 Plus
Dmoj\GI16969-PA 91 GI16969-PA 11..91 49..128 186 50.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 18:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16790-PA 125 GL16790-PA 1..125 1..128 355 60.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 18:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24294-PA 125 GA24294-PA 1..125 1..128 355 60.2 Plus
Dpse\GA24295-PA 125 GA24295-PA 6..125 5..128 249 47.2 Plus
Dpse\GA27416-PA 111 GA27416-PA 2..111 20..128 156 33.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21811-PA 221 GM21811-PA 1..120 1..120 546 95.8 Plus
Dsec\GM21811-PA 221 GM21811-PA 125..221 28..128 145 44.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11302-PA 170 GD11302-PA 8..69 59..120 322 98.4 Plus
Dsim\GD11302-PA 170 GD11302-PA 74..170 28..128 141 43.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 18:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20580-PA 90 GJ20580-PA 10..90 49..128 193 51.9 Plus
Dvir\GJ13632-PA 81 GJ13632-PA 10..81 54..128 160 48 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 18:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15663-PA 84 GK15663-PA 4..84 48..128 282 67.9 Plus
Dwil\GK15665-PA 147 GK15665-PA 6..147 5..128 213 39.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 18:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11885-PA 175 GE11885-PA 4..74 48..118 306 95.8 Plus
Dyak\GE11885-PA 175 GE11885-PA 79..152 28..103 158 53.9 Plus