Clone IP04124 Report

Search the DGRC for IP04124

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:41
Well:24
Vector:pOT2
Associated Gene/TranscriptCG12691-RA
Protein status:IP04124.pep: gold
Preliminary Size:453
Sequenced Size:592

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12691 2005-01-01 Successful iPCR screen
CG12691 2008-04-29 Release 5.5 accounting
CG12691 2008-08-15 Release 5.9 accounting
CG12691 2008-12-18 5.12 accounting

Clone Sequence Records

IP04124.complete Sequence

592 bp assembled on 2006-11-09

GenBank Submission: BT023000

> IP04124.complete
TCACATCAACAGTTACATATTTTAGGCAGGAACTGTCTCCGCACAGAGCC
CACAGATCGCAGGATGTTGCACAGCAGCTACAATCGCGCACCGCGCCGCA
AACTCATTCCGAATTTGTTTAGCAACATCCTACAGGTGATCGCCGATGCC
GACCATCCGCTCACCGAACCCGAGATCATGGACGCGGTCGCCGATCGGTT
GGATCGCAGCGACGAGGAGCTGAAGCGCCAGATCACAGTAAGCCTCCACG
ACGCCCTAATCTACGGCTATCTGCGAGTGAAGAACTATCGTTACTCGATA
GTGCCCAGTCGCCTGGATCCGGACGAACATCGCGATCATAACGAGCCCAG
TTCCTCCATCACCGCCGCCCCGGAACATAGTCGGCTGCAGGAGAGGATCT
CGAGTGGAACCAGTGCTGCCATGGTTGACAACCAGGGTCGCGATGAAGAA
CTCACACCAAAAAGCACTCAGGCGCTAAAGAGGTTAAATGCTGAGCCGCA
AGGGCAAACTAATTGATAGAAGAAAATTTCAAATGTAAACTTTTAATAAA
TTGAATTAAAATCAAATAAAACCAAAAAAAAAAAAAAAAAAA

IP04124.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG12691-RA 557 CG12691-RA 1..557 1..557 2785 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4159150..4159722 1..573 2865 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:51:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4266097..4266671 1..575 2875 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4274195..4274769 1..575 2875 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:51:21 has no hits.

IP04124.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:52:20 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4159150..4159722 1..573 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:56 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..453 64..516 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:42 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..453 64..516 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:20:22 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..453 64..516 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:08 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..453 64..516 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:34 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..453 64..516 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:05 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..453 64..516 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:42 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..573 1..573 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:20:22 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..573 1..573 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:09 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..453 64..516 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:34 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
CG12691-RA 1..573 1..573 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:20 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
X 4266097..4266669 1..573 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:20 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
X 4266097..4266669 1..573 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:52:20 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
X 4266097..4266669 1..573 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:20:22 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4160130..4160702 1..573 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:00 Download gff for IP04124.complete
Subject Subject Range Query Range Percent Splice Strand
X 4274195..4274767 1..573 100   Plus

IP04124.hyp Sequence

Translation from 0 to 515

> IP04124.hyp
SHQQLHILGRNCLRTEPTDRRMLHSSYNRAPRRKLIPNLFSNILQVIADA
DHPLTEPEIMDAVADRLDRSDEELKRQITVSLHDALIYGYLRVKNYRYSI
VPSRLDPDEHRDHNEPSSSITAAPEHSRLQERISSGTSAAMVDNQGRDEE
LTPKSTQALKRLNAEPQGQTN*

IP04124.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG12691-PA 150 CG12691-PA 1..150 22..171 766 100 Plus

IP04124.pep Sequence

Translation from 63 to 515

> IP04124.pep
MLHSSYNRAPRRKLIPNLFSNILQVIADADHPLTEPEIMDAVADRLDRSD
EELKRQITVSLHDALIYGYLRVKNYRYSIVPSRLDPDEHRDHNEPSSSIT
AAPEHSRLQERISSGTSAAMVDNQGRDEELTPKSTQALKRLNAEPQGQTN
*

IP04124.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:33:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20789-PA 164 GF20789-PA 1..122 1..115 391 67.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18700-PA 150 GG18700-PA 1..150 1..150 729 91.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24284-PA 144 GH24284-PA 31..130 1..98 347 66 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG12691-PA 150 CG12691-PA 1..150 1..150 766 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16408-PA 128 GI16408-PA 7..97 7..97 367 74.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:33:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14191-PA 192 GL14191-PA 1..87 1..87 338 74.7 Plus
Dper\GL14189-PA 92 GL14189-PA 5..77 12..84 142 37 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11759-PA 270 GA11759-PA 1..87 1..87 333 73.6 Plus
Dpse\GA13823-PA 101 GA13823-PA 14..86 12..84 143 37 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12336-PA 150 GM12336-PA 1..150 1..150 756 96.7 Plus
Dsec\GM12337-PA 253 GM12337-PA 152..222 11..81 137 35.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:33:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19808-PA 106 GD19808-PA 26..106 70..150 394 93.8 Plus
Dsim\GD19910-PA 86 GD19910-PA 6..86 66..150 348 84.7 Plus
Dsim\GD16683-PA 503 GD16683-PA 402..472 11..81 143 35.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17028-PA 131 GJ17028-PA 1..105 1..105 374 68.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17533-PA 197 GK17533-PA 1..130 1..137 382 56.4 Plus
Dwil\GK17523-PA 99 GK17523-PA 4..81 5..79 145 44.9 Plus
Dwil\GK15636-PA 406 GK15636-PA 337..392 16..71 145 44.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16337-PA 150 GE16337-PA 1..150 1..150 724 93.3 Plus