Clone IP04153 Report

Search the DGRC for IP04153

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:41
Well:53
Vector:pOT2
Associated Gene/TranscriptCG13481-RB
Protein status:IP04153.pep: gold
Preliminary Size:453
Sequenced Size:738

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13481 2005-01-01 Successful iPCR screen
CG13481 2008-04-29 Release 5.5 accounting
CG13481 2008-08-15 Release 5.9 accounting
CG13481 2008-12-18 5.12 accounting

Clone Sequence Records

IP04153.complete Sequence

738 bp (738 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022984

> IP04153.complete
ACAACTAAAAGTAACAACCTAGCAATCCGACTTGCAAGAAAGATTTTTGT
CATCACAATACACAATGTCGTCGAACAGCTCGGAGTCCCTAAACAAGATG
AAGTCTCTTGTGGGGAAGATGATCTTCATGCAAGTCACCGAACATCTTTT
CCTAAGGGCGCAGCAGTTGCTGGATTCTGATGTCAGCATAGAAGAACGTG
TGCGCAGAATGGAGGTCCTTAACAACAACATGAAGTGGTTCAATTCCGAG
CGTACACGCATCCTAGAGCAGTTGCAGCTGAATATATTCGGTCAGATTTC
GGTGGAGCATCATAATGCGATGAATATGAGTGAGAATCTGTATGAGCTGC
GCGAGGGACTAGACGGACTCAGCCGTAGGATGGAAAGTATGCAAGAGGAC
ATTACCTGTTCGATTTGCCTCTCACCCTGGTCTTCCAATGGCAGACATCG
AGTGGTCTCTCTCCGATGTGGACACCTATTCGGGAATAGCTGCATCAGAA
CTGCCATCCGCAGATCACATCGGTGCCCGATATGCAGGCGTAGGGCTCTA
CACGCTGATGTGCGCAGGATATTCAGTCGACGAATAAGTCATTAACACTG
GAAACCACTGCGTTCTAGTTCAATGTTTATATATTCAAAACGTTTCAATT
ACTTATTGAACAAATAGCTGCGATTAAAAATTAAACAGCAAAAGCGATAC
TCGAAATGATCCATAAAAAAAAAAAAAAAAAAAAAAAA

IP04153.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG13481-RB 719 CG13481-RB 1..719 1..719 3595 100 Plus
CG13481.a 696 CG13481.a 36..421 1..386 1930 100 Plus
CG13481.a 696 CG13481.a 415..696 438..719 1380 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:48:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14359087..14359800 714..1 3570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:48:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14368984..14369707 724..1 3605 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14362084..14362807 724..1 3605 99.8 Minus
Blast to na_te.dros performed on 2019-03-15 19:48:04 has no hits.

IP04153.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:49:03 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14359087..14359800 1..714 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:04 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:13 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:58:12 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:04 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..531 65..595 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:24:18 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..531 65..595 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:54 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..714 1..714 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:13 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..714 1..714 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:58:12 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..714 1..714 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:04 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..714 1..714 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:24:18 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
CG13481-RB 1..714 1..714 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:49:03 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14368994..14369707 1..714 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:49:03 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14368994..14369707 1..714 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:49:03 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14368994..14369707 1..714 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:58:12 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14362094..14362807 1..714 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:37 Download gff for IP04153.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14362094..14362807 1..714 100   Minus

IP04153.pep Sequence

Translation from 64 to 594

> IP04153.pep
MSSNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRME
VLNNNMKWFNSERTRILEQLQLNIFGQISVEHHNAMNMSENLYELREGLD
GLSRRMESMQEDITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRR
SHRCPICRRRALHADVRRIFSRRISH*

IP04153.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21156-PA 369 GF21156-PA 218..366 26..174 265 40.8 Plus
Dana\GF11644-PA 261 GF11644-PA 110..191 89..170 230 45.1 Plus
Dana\GF21387-PA 378 GF21387-PA 153..235 92..174 227 45.8 Plus
Dana\GF20023-PA 161 GF20023-PA 81..157 99..174 218 51.9 Plus
Dana\GF10504-PA 763 GF10504-PA 274..348 106..174 190 44 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13729-PA 176 GG13729-PA 1..174 1..174 709 77.6 Plus
Dere\GG25198-PA 177 GG25198-PA 37..175 38..175 314 47.9 Plus
Dere\GG21800-PA 134 GG21800-PA 22..130 64..175 263 43.8 Plus
Dere\GG14234-PA 163 GG14234-PA 30..156 39..170 201 34.8 Plus
Dere\GG20119-PA 156 GG20119-PA 83..151 102..170 197 50.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15222-PA 692 GH15222-PA 206..279 107..174 185 44.6 Plus
Dgri\GH13524-PA 158 GH13524-PA 84..154 99..169 150 38 Plus
Dgri\GH13397-PA 171 GH13397-PA 92..171 97..172 136 35 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13481-PC 176 CG13481-PC 1..176 1..176 910 100 Plus
CG13481-PB 176 CG13481-PB 1..176 1..176 910 100 Plus
CG17329-PA 162 CG17329-PA 22..156 38..171 333 49.6 Plus
CG31807-PB 142 CG31807-PB 8..137 33..169 231 37.2 Plus
CG31807-PA 155 CG31807-PA 21..150 33..169 231 37.2 Plus
CG14983-PA 163 CG14983-PA 26..156 35..170 217 35.3 Plus
CG13025-PB 608 CG13025-PB 111..196 95..174 199 41.9 Plus
CG13025-PA 608 CG13025-PA 111..196 95..174 199 41.9 Plus
CG33552-PA 157 CG33552-PA 19..146 42..171 145 31.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13216-PA 214 GI13216-PA 44..214 9..174 202 30.6 Plus
Dmoj\GI12097-PA 263 GI12097-PA 199..255 114..170 188 50.9 Plus
Dmoj\GI11932-PA 684 GI11932-PA 199..268 111..174 183 45.7 Plus
Dmoj\GI15028-PA 241 GI15028-PA 164..237 94..170 180 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15997-PA 175 GL15997-PA 110..169 99..158 211 58.3 Plus
Dper\GL15116-PA 178 GL15116-PA 88..174 89..172 201 44.8 Plus
Dper\GL15113-PA 259 GL15113-PA 194..254 114..174 193 50.8 Plus
Dper\GL15993-PA 270 GL15993-PA 62..266 4..174 187 27.5 Plus
Dper\GL19299-PA 159 GL19299-PA 100..156 115..170 158 45.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26106-PA 186 GA26106-PA 111..183 99..171 221 52.1 Plus
Dpse\GA25513-PA 178 GA25513-PA 88..174 89..172 207 46 Plus
Dpse\GA25508-PA 301 GA25508-PA 236..296 114..174 193 50.8 Plus
Dpse\GA26105-PA 270 GA26105-PA 60..266 2..174 192 27.5 Plus
Dpse\GA11982-PA 677 GA11982-PA 195..264 111..174 189 45.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24551-PA 150 GM24551-PA 1..116 1..116 476 82.8 Plus
Dsec\GM18662-PA 176 GM18662-PA 1..170 1..171 340 43.6 Plus
Dsec\GM18080-PA 164 GM18080-PA 5..150 35..176 213 31.5 Plus
Dsec\GM17169-PA 155 GM17169-PA 1..151 1..170 210 30.6 Plus
Dsec\GM24368-PA 601 GM24368-PA 104..189 95..174 196 41.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12623-PA 150 GD12623-PA 12..116 12..116 431 81.9 Plus
Dsim\GD24047-PA 176 GD24047-PA 1..170 1..171 341 43.6 Plus
Dsim\GD22698-PA 164 GD22698-PA 5..150 35..176 217 32.7 Plus
Dsim\GD21906-PA 155 GD21906-PA 1..151 1..170 208 30 Plus
Dsim\GD13307-PA 163 GD13307-PA 26..156 35..170 185 33.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11990-PA 229 GJ11990-PA 168..229 113..174 191 45.2 Plus
Dvir\GJ13370-PA 108 GJ13370-PA 5..101 68..170 190 38.8 Plus
Dvir\GJ12158-PA 680 GJ12158-PA 189..261 110..174 185 46.6 Plus
Dvir\GJ11989-PA 96 GJ11989-PA 33..93 111..171 176 45.9 Plus
Dvir\GJ15380-PA 258 GJ15380-PA 129..253 46..170 169 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13567-PA 671 GK13567-PA 188..257 111..174 186 44.3 Plus
Dwil\GK19353-PA 135 GK19353-PA 66..129 111..174 163 43.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:00:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20024-PA 176 GE20024-PA 1..174 1..174 675 73.6 Plus
Dyak\GE11876-PA 220 GE11876-PA 17..220 1..171 334 36.3 Plus
Dyak\GE13175-PA 154 GE13175-PA 65..149 86..170 217 45.9 Plus
Dyak\GE14698-PA 263 GE14698-PA 73..228 9..171 203 33.1 Plus
Dyak\GE22190-PA 662 GE22190-PA 165..250 95..174 194 40.7 Plus

IP04153.hyp Sequence

Translation from 64 to 594

> IP04153.hyp
MSSNSSESLNKMKSLVGKMIFMQVTEHLFLRAQQLLDSDVSIEERVRRME
VLNNNMKWFNSERTRILEQLQLNIFGQISVEHHNAMNMSENLYELREGLD
GLSRRMESMQEDITCSICLSPWSSNGRHRVVSLRCGHLFGNSCIRTAIRR
SHRCPICRRRALHADVRRIFSRRISH*

IP04153.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13481-PC 176 CG13481-PC 1..176 1..176 910 100 Plus
CG13481-PB 176 CG13481-PB 1..176 1..176 910 100 Plus
CG17329-PA 162 CG17329-PA 22..156 38..171 333 49.6 Plus
CG31807-PB 142 CG31807-PB 8..137 33..169 231 37.2 Plus
CG31807-PA 155 CG31807-PA 21..150 33..169 231 37.2 Plus