BDGP Sequence Production Resources |
Search the DGRC for IP04156
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 41 |
Well: | 56 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13578-RA |
Protein status: | IP04156.pep: gold |
Preliminary Size: | 429 |
Sequenced Size: | 870 |
Gene | Date | Evidence |
---|---|---|
CG13578 | 2005-01-01 | Successful iPCR screen |
CG13578 | 2008-04-29 | Release 5.5 accounting |
CG13578 | 2008-08-15 | Release 5.9 accounting |
CG13578 | 2008-12-18 | 5.12 accounting |
870 bp (870 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022985
> IP04156.complete TTGTCCCTACAAACGGCTGTGTCCTGGAGGACTAGCATACCTGCGGAAAA TCCAATCCTGCGAAAATCAATACTAATGAGCCATTAAACGTGGCCTCCGC TGCAGTCGGCCGTAGTCTAATGAGCTGAGCGGCGGCGGAAATTGAATGTT GGCTCTAACCAAGCGGCTGCAGAAGGAAATCACATCGGCATCGCTCTTAG CCATCTCTCCGCCGAACGGAAACGGTAAAGGCGAAAGTATCGGTAGCAGG AGCACTAAAACGGAAGTCTTAGGCGTAATGCCTTGCGCCTGAGTGGATGC GTAGCATGGGCTGCTCCAGTTCCAAGACCTCCGCCACCGTAGAAGACACC AAATCATCGAAGCCCTGCTCCTGCTCAGCCAAGTCCAGTACAACGAGAAT GGCCGCCAAGAAGGAGTACCCTGCCTCGGAGGCCTTCACCATTCCTTTGG AGAGCGATGACGGTCCGGAGATGCCGCTAAACGAGACGGTTCGCCAGCCA CCGAAGAGGATTCAGCAACTGATGCAGGAGGCGGCCAGCTCGGAGCCACT CACCTTGGAGGAGCTGGAGGAGAAGCAGCTAAAGGCCGAGCAGAGGCGCC AGGAGCTCATGCAGCAGAAACTGGAGATCATACAAAAGAATGCCCAGATG CTCATGAAGCCTCATGAGGAAACCGTTGGCGAAGGCGAAGGAGACCGGAA CGAAGGCAAGGAGGAACTACCCGAAAAGGTCTAGCTATGTACTTCTTTTT CATTCACATTTTTATTGTTAGCTTTAAATTATATATGTATTACTATATAT CGTAGTATATTTCCAAACAATTAGATTGTATGCAATTAAATCTGCTCTCA TCGTCAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\TART | 8444 | Dyak\TART TARTYAK 8444bp | 7258..7370 | 506..617 | 120 | 59.6 | Plus |
TART-C | 11124 | TART-C TARTC 11124bp | 8711..8823 | 506..617 | 120 | 59.6 | Plus |
Tc3 | 1743 | Tc3 TC3 1743bp | 252..313 | 840..778 | 114 | 68.8 | Minus |
Dkoe\Gandalf | 979 | Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). | 796..848 | 736..790 | 108 | 69.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 20263776..20264195 | 1..420 | 99 | -> | Plus |
chr2R | 20264251..20264685 | 421..855 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..438 | 297..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..438 | 297..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..438 | 297..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..438 | 297..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..438 | 297..734 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..855 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..855 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..855 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..855 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13578-RA | 1..855 | 1..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24377831..24378250 | 1..420 | 100 | -> | Plus |
2R | 24378306..24378740 | 421..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24377831..24378250 | 1..420 | 100 | -> | Plus |
2R | 24378306..24378740 | 421..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24377831..24378250 | 1..420 | 100 | -> | Plus |
2R | 24378306..24378740 | 421..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 20265354..20265773 | 1..420 | 100 | -> | Plus |
arm_2R | 20265829..20266263 | 421..855 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 24379048..24379467 | 1..420 | 100 | -> | Plus |
2R | 24379523..24379957 | 421..855 | 100 | Plus |
Translation from 296 to 733
> IP04156.pep MRSMGCSSSKTSATVEDTKSSKPCSCSAKSSTTRMAAKKEYPASEAFTIP LESDDGPEMPLNETVRQPPKRIQQLMQEAASSEPLTLEELEEKQLKAEQR RQELMQQKLEIIQKNAQMLMKPHEETVGEGEGDRNEGKEELPEKV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11393-PA | 143 | GF11393-PA | 1..120 | 4..136 | 436 | 69.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22962-PA | 138 | GG22962-PA | 1..138 | 4..145 | 554 | 89.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20990-PA | 141 | GH20990-PA | 1..124 | 4..127 | 334 | 58.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13578-PA | 145 | CG13578-PA | 1..145 | 1..145 | 732 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21323-PA | 144 | GI21323-PA | 1..135 | 4..139 | 340 | 54 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20057-PA | 126 | GL20057-PA | 1..124 | 4..133 | 431 | 69.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12372-PA | 127 | GA12372-PA | 1..125 | 4..135 | 438 | 70.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11855-PA | 146 | GM11855-PA | 1..146 | 4..145 | 532 | 87.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11853-PA | 113 | GD11853-PA | 1..113 | 35..145 | 455 | 92 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21596-PA | 150 | GJ21596-PA | 1..127 | 4..125 | 305 | 61.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22206-PA | 142 | GK22206-PA | 1..142 | 4..140 | 394 | 59 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE14399-PA | 142 | GE14399-PA | 1..142 | 4..145 | 561 | 88.9 | Plus |
Translation from 296 to 733
> IP04156.hyp MRSMGCSSSKTSATVEDTKSSKPCSCSAKSSTTRMAAKKEYPASEAFTIP LESDDGPEMPLNETVRQPPKRIQQLMQEAASSEPLTLEELEEKQLKAEQR RQELMQQKLEIIQKNAQMLMKPHEETVGEGEGDRNEGKEELPEKV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13578-PA | 145 | CG13578-PA | 1..145 | 1..145 | 732 | 100 | Plus |