Clone IP04156 Report

Search the DGRC for IP04156

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:41
Well:56
Vector:pOT2
Associated Gene/TranscriptCG13578-RA
Protein status:IP04156.pep: gold
Preliminary Size:429
Sequenced Size:870

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13578 2005-01-01 Successful iPCR screen
CG13578 2008-04-29 Release 5.5 accounting
CG13578 2008-08-15 Release 5.9 accounting
CG13578 2008-12-18 5.12 accounting

Clone Sequence Records

IP04156.complete Sequence

870 bp (870 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022985

> IP04156.complete
TTGTCCCTACAAACGGCTGTGTCCTGGAGGACTAGCATACCTGCGGAAAA
TCCAATCCTGCGAAAATCAATACTAATGAGCCATTAAACGTGGCCTCCGC
TGCAGTCGGCCGTAGTCTAATGAGCTGAGCGGCGGCGGAAATTGAATGTT
GGCTCTAACCAAGCGGCTGCAGAAGGAAATCACATCGGCATCGCTCTTAG
CCATCTCTCCGCCGAACGGAAACGGTAAAGGCGAAAGTATCGGTAGCAGG
AGCACTAAAACGGAAGTCTTAGGCGTAATGCCTTGCGCCTGAGTGGATGC
GTAGCATGGGCTGCTCCAGTTCCAAGACCTCCGCCACCGTAGAAGACACC
AAATCATCGAAGCCCTGCTCCTGCTCAGCCAAGTCCAGTACAACGAGAAT
GGCCGCCAAGAAGGAGTACCCTGCCTCGGAGGCCTTCACCATTCCTTTGG
AGAGCGATGACGGTCCGGAGATGCCGCTAAACGAGACGGTTCGCCAGCCA
CCGAAGAGGATTCAGCAACTGATGCAGGAGGCGGCCAGCTCGGAGCCACT
CACCTTGGAGGAGCTGGAGGAGAAGCAGCTAAAGGCCGAGCAGAGGCGCC
AGGAGCTCATGCAGCAGAAACTGGAGATCATACAAAAGAATGCCCAGATG
CTCATGAAGCCTCATGAGGAAACCGTTGGCGAAGGCGAAGGAGACCGGAA
CGAAGGCAAGGAGGAACTACCCGAAAAGGTCTAGCTATGTACTTCTTTTT
CATTCACATTTTTATTGTTAGCTTTAAATTATATATGTATTACTATATAT
CGTAGTATATTTCCAAACAATTAGATTGTATGCAATTAAATCTGCTCTCA
TCGTCAAAAAAAAAAAAAAA

IP04156.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG13578-RA 1018 CG13578-RA 164..1018 1..855 4275 100 Plus
CG13578.a 1226 CG13578.a 372..1226 1..855 4275 100 Plus
mAcR-60C-RB 4833 mAcR-60C-RB 4725..4833 859..751 545 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20264251..20264685 421..855 2145 99.5 Plus
chr2R 21145070 chr2R 20263776..20264193 1..418 2075 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24378306..24378744 421..859 2195 100 Plus
2R 25286936 2R 24377831..24378250 1..420 2100 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24379505..24379943 421..859 2195 100 Plus
2R 25260384 2R 24379030..24379449 1..420 2100 100 Plus
Blast to na_te.dros performed 2019-03-15 17:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 7258..7370 506..617 120 59.6 Plus
TART-C 11124 TART-C TARTC 11124bp 8711..8823 506..617 120 59.6 Plus
Tc3 1743 Tc3 TC3 1743bp 252..313 840..778 114 68.8 Minus
Dkoe\Gandalf 979 Dkoe\Gandalf DK29466 979bp Derived from U29466 (Rel. 63, Last updated, Version 5). 796..848 736..790 108 69.1 Plus

IP04156.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:40:41 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20263776..20264195 1..420 99 -> Plus
chr2R 20264251..20264685 421..855 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:05 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..438 297..734 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:15 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..438 297..734 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:43:00 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..438 297..734 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:07:05 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..438 297..734 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:43:51 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..438 297..734 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:56 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..855 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:14 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..855 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:43:00 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..855 1..855 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:07:05 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..855 1..855 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:43:51 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
CG13578-RA 1..855 1..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:41 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24377831..24378250 1..420 100 -> Plus
2R 24378306..24378740 421..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:41 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24377831..24378250 1..420 100 -> Plus
2R 24378306..24378740 421..855 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:40:41 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24377831..24378250 1..420 100 -> Plus
2R 24378306..24378740 421..855 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:43:00 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20265354..20265773 1..420 100 -> Plus
arm_2R 20265829..20266263 421..855 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:38 Download gff for IP04156.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24379048..24379467 1..420 100 -> Plus
2R 24379523..24379957 421..855 100   Plus

IP04156.pep Sequence

Translation from 296 to 733

> IP04156.pep
MRSMGCSSSKTSATVEDTKSSKPCSCSAKSSTTRMAAKKEYPASEAFTIP
LESDDGPEMPLNETVRQPPKRIQQLMQEAASSEPLTLEELEEKQLKAEQR
RQELMQQKLEIIQKNAQMLMKPHEETVGEGEGDRNEGKEELPEKV*

IP04156.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:00:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11393-PA 143 GF11393-PA 1..120 4..136 436 69.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22962-PA 138 GG22962-PA 1..138 4..145 554 89.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:00:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20990-PA 141 GH20990-PA 1..124 4..127 334 58.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13578-PA 145 CG13578-PA 1..145 1..145 732 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21323-PA 144 GI21323-PA 1..135 4..139 340 54 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:00:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20057-PA 126 GL20057-PA 1..124 4..133 431 69.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12372-PA 127 GA12372-PA 1..125 4..135 438 70.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:00:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11855-PA 146 GM11855-PA 1..146 4..145 532 87.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:00:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11853-PA 113 GD11853-PA 1..113 35..145 455 92 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21596-PA 150 GJ21596-PA 1..127 4..125 305 61.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:00:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22206-PA 142 GK22206-PA 1..142 4..140 394 59 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:00:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14399-PA 142 GE14399-PA 1..142 4..145 561 88.9 Plus

IP04156.hyp Sequence

Translation from 296 to 733

> IP04156.hyp
MRSMGCSSSKTSATVEDTKSSKPCSCSAKSSTTRMAAKKEYPASEAFTIP
LESDDGPEMPLNETVRQPPKRIQQLMQEAASSEPLTLEELEEKQLKAEQR
RQELMQQKLEIIQKNAQMLMKPHEETVGEGEGDRNEGKEELPEKV*

IP04156.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13578-PA 145 CG13578-PA 1..145 1..145 732 100 Plus