Clone IP04208 Report

Search the DGRC for IP04208

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:8
Vector:pOT2
Associated Gene/TranscriptSkpE-RA
Protein status:IP04208.pep: gold
Preliminary Size:504
Sequenced Size:758

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
skpE 2008-12-18 5.12 accounting

Clone Sequence Records

IP04208.complete Sequence

758 bp assembled on 2008-12-15

GenBank Submission: BT056267.1

> IP04208.complete
CCACGTGGTCTTTCATTATCGCATCTTCTGACTCTCTTTTTTAAAGTAGT
TTGGCAAATTGAGAGGCAACGCAAACTGAAAATGGTTACTCCCACCATCA
AGCTTGAGTCCTCGGAAGGGGTGATCTTTCCGACGGAAGTCCGAGTCGCC
ATGGTCTCCGAAACCATCAAGACCATGTTGGATCACTTTGCCGTGCAGAA
CGACGAGAATGCCATCGTGCCCCTGCACTCGGTGAGCACGTTCACCCTGG
GCAAGATTCTAGCCTGGGCCAATCACCACAAGGACGATGATGATCAGTCA
ACGGAGGGTGAGGAGCTGAAGCCACGTCGCCCATATGCCATCTCCCCATG
GGACGCCATCTTCTTGATGGTCAATTCAACCACCTTGCTCGAAATCATAC
TGGCCGCCAAACAACTGCAGATCAAGGGCCTACTGGAACTCACCTACAAT
GTGGTGGCCAATATGATTAGGGGCAAGACTCCCGAGGAGATCCGCTTCAT
CTTCAACATTCCGGAAGACGTCTCGCCATCCGTGGACGGGGAGTTGAGAT
GGAAAGACCTGTTTTTGTGGCCCATGGATTTCTGAGCCGCTGGGACTGTT
GACCGTATTTTAGTTTGGACACCTGCAAATGAAGAAGAAATTTTTTACTT
AGTTAAGAATAAGAACATTTTGAGTTAACCTAAATATATACTGCCGCCAG
TGTTGGAGAAGGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

IP04208.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
skpE-RA 713 skpE-RA 1..713 1..713 3565 100 Plus
skpC-RA 477 skpC-RA 1..434 82..515 970 81.5 Plus
skpD-RA 660 skpD-RA 36..423 45..432 905 82.2 Plus
skpD-RA 660 skpD-RA 446..486 455..495 190 97.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19712031..19712743 713..1 3565 100 Minus
chrX 22417052 chrX 19704757..19705237 35..515 1100 81.9 Plus
chrX 22417052 chrX 19701428..19701878 45..495 1055 82.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19823367..19824080 714..1 3570 100 Minus
X 23542271 X 19816091..19816571 35..515 1100 81.9 Plus
X 23542271 X 19812764..19813214 45..495 1040 82 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19831465..19832178 714..1 3570 100 Minus
X 23527363 X 19824189..19824669 35..515 1100 81.9 Plus
X 23527363 X 19820862..19821249 45..432 905 82.2 Plus
X 23527363 X 19821272..19821312 455..495 190 97.5 Plus
X 23527363 X 665541..665627 424..510 165 79.3 Plus
X 23527363 X 665211..665341 91..221 145 74 Plus
Blast to na_te.dros performed 2019-03-16 00:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 58..95 663..627 115 81.6 Minus
Dvir\Paris 1730 Dvir\Paris TV1 1730bp Derived from Z49253. 1636..1673 627..663 115 81.6 Plus
Tirant 8526 Tirant TIRANT 8526bp 3271..3345 614..690 110 62.3 Plus

IP04208.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:51:30 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19712031..19712743 1..713 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:04:16 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
skpE-RA 1..504 82..585 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:45:06 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
skpE-RA 1..504 82..585 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:58:56 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
skpE-RA 1..504 82..585 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:15:22 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
SkpE-RA 1..504 82..585 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-15 18:01:38 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
skpE-RA 1..504 82..585 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:45:06 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
skpE-RA 1..504 82..585 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:58:56 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
skpE-RA 1..504 82..585 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:15:22 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
SkpE-RA 1..713 1..713 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:51:30 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
X 19823368..19824080 1..713 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:51:30 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
X 19823368..19824080 1..713 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:51:30 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
X 19823368..19824080 1..713 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:58:56 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19717401..19718113 1..713 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:30:47 Download gff for IP04208.complete
Subject Subject Range Query Range Percent Splice Strand
X 19831466..19832178 1..713 100   Minus

IP04208.hyp Sequence

Translation from 0 to 584

> IP04208.hyp
PRGLSLSHLLTLFFKVVWQIERQRKLKMVTPTIKLESSEGVIFPTEVRVA
MVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKDDDDQS
TEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYN
VVANMIRGKTPEEIRFIFNIPEDVSPSVDGELRWKDLFLWPMDF*

IP04208.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
SkpE-PA 167 CG11942-PA 1..167 28..194 863 100 Plus
SkpD-PA 158 CG12700-PA 1..147 28..174 471 63.9 Plus
SkpC-PA 158 CG11941-PA 1..154 28..182 469 62.6 Plus
SkpA-PI 162 CG16983-PI 2..153 31..183 399 54.9 Plus
SkpA-PH 162 CG16983-PH 2..153 31..183 399 54.9 Plus

IP04208.pep Sequence

Translation from 0 to 584

> IP04208.pep
PRGLSLSHLLTLFFKVVWQIERQRKLKMVTPTIKLESSEGVIFPTEVRVA
MVSETIKTMLDHFAVQNDENAIVPLHSVSTFTLGKILAWANHHKDDDDQS
TEGEELKPRRPYAISPWDAIFLMVNSTTLLEIILAAKQLQIKGLLELTYN
VVANMIRGKTPEEIRFIFNIPEDVSPSVDGELRWKDLFLWPMDF*

IP04208.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:11:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21176-PA 248 GF21176-PA 5..154 33..183 389 54.3 Plus
Dana\GF12644-PA 161 GF12644-PA 2..152 31..183 356 49 Plus
Dana\GF11136-PA 161 GF11136-PA 2..152 31..183 343 47.7 Plus
Dana\GF11848-PA 179 GF11848-PA 2..162 31..186 313 43.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12805-PA 162 GG12805-PA 2..153 31..183 405 54.2 Plus
Dere\GG19259-PA 157 GG19259-PA 1..142 28..170 375 55.9 Plus
Dere\GG20030-PA 170 GG20030-PA 2..147 31..177 334 46.9 Plus
Dere\GG22608-PA 162 GG22608-PA 2..152 31..183 321 45.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24518-PA 162 GH24518-PA 2..153 31..183 406 53.6 Plus
Dgri\GH19712-PA 162 GH19712-PA 2..153 31..183 405 52.9 Plus
Dgri\GH20861-PA 162 GH20861-PA 2..153 31..183 322 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
SkpE-PA 167 CG11942-PA 1..167 28..194 863 100 Plus
SkpD-PA 158 CG12700-PA 1..147 28..174 471 63.9 Plus
SkpC-PA 158 CG11941-PA 1..154 28..182 469 62.6 Plus
SkpA-PI 162 CG16983-PI 2..153 31..183 399 54.9 Plus
SkpA-PH 162 CG16983-PH 2..153 31..183 399 54.9 Plus
SkpA-PA 162 CG16983-PA 2..153 31..183 399 54.9 Plus
SkpA-PD 162 CG16983-PD 2..153 31..183 399 54.9 Plus
SkpA-PG 162 CG16983-PG 2..153 31..183 399 54.9 Plus
SkpA-PB 162 CG16983-PB 2..153 31..183 399 54.9 Plus
SkpA-PC 162 CG16983-PC 2..153 31..183 399 54.9 Plus
SkpA-PF 162 CG16983-PF 2..153 31..183 399 54.9 Plus
SkpA-PE 162 CG16983-PE 2..153 31..183 399 54.9 Plus
SkpF-PA 171 CG12227-PA 2..147 31..177 315 45.6 Plus
SkpB-PA 161 CG8881-PA 2..152 31..183 304 44.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15084-PA 162 GI15084-PA 2..153 31..183 399 52.9 Plus
Dmoj\GI20969-PA 162 GI20969-PA 2..153 31..183 335 44.4 Plus
Dmoj\GI11198-PA 148 GI11198-PA 4..139 33..170 304 48.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15335-PA 162 GL15335-PA 2..153 31..183 406 54.2 Plus
Dper\GL13359-PA 162 GL13359-PA 2..153 31..183 403 54.2 Plus
Dper\GL13358-PA 162 GL13358-PA 2..153 31..183 403 54.2 Plus
Dper\GL14141-PA 162 GL14141-PA 2..153 31..183 403 54.2 Plus
Dper\GL27172-PA 164 GL27172-PA 2..155 31..183 373 49.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14255-PA 162 GA14255-PA 2..153 31..183 402 54.2 Plus
Dpse\GA26756-PA 164 GA26756-PA 2..155 31..183 372 49.4 Plus
Dpse\GA26757-PA 164 GA26757-PA 2..155 31..183 353 48.1 Plus
Dpse\GA21386-PA 162 GA21386-PA 2..153 31..183 338 48.1 Plus
Dpse\GA24828-PA 169 GA24828-PA 2..147 31..171 275 41.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22995-PA 168 GM22995-PA 16..157 33..174 431 62.7 Plus
Dsec\GM19084-PA 162 GM19084-PA 2..153 31..183 408 54.9 Plus
Dsec\GM20386-PA 161 GM20386-PA 2..152 31..183 313 44.4 Plus
Dsec\GM15542-PA 170 GM15542-PA 2..147 31..177 292 46.9 Plus
Dsec\GM22705-PA 110 GM22705-PA 1..56 28..83 137 55.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17469-PA 157 GD17469-PA 16..157 33..174 411 59.2 Plus
Dsim\GD16521-PA 162 GD16521-PA 2..153 31..183 408 54.9 Plus
Dsim\GD25859-PA 161 GD25859-PA 2..152 31..183 316 45.1 Plus
Dsim\GD25046-PA 170 GD25046-PA 2..147 31..177 292 46.9 Plus
Dsim\GD16344-PA 154 GD16344-PA 2..111 25..190 272 40.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18891-PA 200 GJ18891-PA 36..191 25..183 408 52.8 Plus
Dvir\GJ20688-PA 162 GJ20688-PA 2..153 31..183 337 45.1 Plus
Dvir\GJ18483-PA 150 GJ18483-PA 4..143 33..172 311 48.2 Plus
Dvir\GJ22314-PA 140 GJ22314-PA 2..135 31..177 232 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16428-PA 162 GK16428-PA 2..153 31..183 396 53.6 Plus
Dwil\GK21211-PA 162 GK21211-PA 3..153 32..183 382 52 Plus
Dwil\GK23055-PA 154 GK23055-PA 2..144 31..177 356 49.7 Plus
Dwil\GK21342-PA 161 GK21342-PA 2..152 31..183 341 47.1 Plus
Dwil\GK10153-PA 166 GK10153-PA 2..143 31..173 341 51.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\skpA-PA 162 GE16631-PA 2..153 31..183 402 53.6 Plus
Dyak\GE13476-PA 162 GE13476-PA 2..152 31..183 326 45.8 Plus
Dyak\GE11566-PA 172 GE11566-PA 2..146 31..177 316 44.2 Plus