Clone IP04222 Report

Search the DGRC for IP04222

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:22
Vector:pOT2
Associated Gene/TranscriptCG12680-RB
Protein status:IP04222.pep: gold
Preliminary Size:453
Sequenced Size:814

Clone Sequence Records

IP04222.complete Sequence

814 bp assembled on 2009-07-01

GenBank Submission: BT088897.1

> IP04222.complete
ATTTGTATTTGCCGCATTTCGAAATGAATCGATTTCGAGACACACACTGA
CGCACAGCAGATTGTATTGGCGAATCGGTAAGGACAAACGGTTCGTGGAT
GGAGCTGGCAGGGATTAGGTACGGGTTCAGCTTGTGGCTCCTCTTGCTCC
ATTTCAGCTGTATCCTGGCCATCATCGATCACACAAAATGCAAAGAATGC
GAACAGTACAAATACAAATTGCCAGAGAGATGCAAATATTTGGTGGAGGA
TATTCATGTGTTTGAGCGAAAATGTGGCGGCACATATCCACTAATGGCAT
TTACCAAATATCGGGATACATTCGTTAAGACCGGCGAACCATATTCCCTG
TACATGCCAAGCTCCTTGGATCATGTGCTTCTGCTGATGAAGGACTCCGC
ATTGCAGAGCTGTGCGCGCATTCAAGTGGGCGATACGAACACGTTCTTTT
GCCTGGACGATAGCACCAATGAGACGATCAAACTGGATGTGGCCCACATG
TATTGCTTCCCATTTCACATCCAGCTGCCGGATGATCTGATGCAGGAGTG
CCTCATAGAGAATGAGATGACCAATGGCTTTCTGAACGATATCCTTCGCA
CACGACGCGGCATCATCCACTATACCTTTGGCTCTAGTCGGGGCCATCGT
CTCAATTGTGGATATTTGTTGCCGAATCTCCTGCTCCTCGTGCCTCATCT
CCTGCCATCGATGATGAGTCGTAAATTTTTATGCGAGCTGCCATAAAGAT
TGATCGGTTAAGCCAAAAAGGGGATGGCATTAAGCAAAAATTGCTTTAAA
AAAAAAAAAAAAAA

IP04222.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12680-RB 797 CG12680-RB 1..797 1..797 3985 100 Plus
nc_21958.a 739 nc_21958.a 66..723 157..814 3260 99.6 Plus
nc_21958.a 739 nc_21958.a 1..66 12..77 330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4890161..4890957 1..797 3985 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:12:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4997441..4998254 1..814 4040 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 5005539..5006352 1..814 4040 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 18:12:43 has no hits.

IP04222.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:13:37 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4890161..4890957 1..797 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:23 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..648 99..746 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:32 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..648 99..746 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:46:43 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..648 99..746 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:33:41 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..648 99..746 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-01 15:36:08 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..648 99..746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:32 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..648 99..746 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:46:43 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..797 1..797 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:33:41 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
CG12680-RB 1..797 1..797 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:37 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
X 4997441..4998237 1..797 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:37 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
X 4997441..4998237 1..797 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:13:37 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
X 4997441..4998237 1..797 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:46:43 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4891474..4892270 1..797 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:25:17 Download gff for IP04222.complete
Subject Subject Range Query Range Percent Splice Strand
X 5005539..5006335 1..797 100   Plus

IP04222.pep Sequence

Translation from 98 to 745

> IP04222.pep
MELAGIRYGFSLWLLLLHFSCILAIIDHTKCKECEQYKYKLPERCKYLVE
DIHVFERKCGGTYPLMAFTKYRDTFVKTGEPYSLYMPSSLDHVLLLMKDS
ALQSCARIQVGDTNTFFCLDDSTNETIKLDVAHMYCFPFHIQLPDDLMQE
CLIENEMTNGFLNDILRTRRGIIHYTFGSSRGHRLNCGYLLPNLLLLVPH
LLPSMMSRKFLCELP*

IP04222.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20334-PA 264 GF20334-PA 72..227 40..197 529 60.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:11:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18738-PA 210 GG18738-PA 1..210 1..215 880 80.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13552-PA 199 GH13552-PA 31..170 41..177 325 42.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12680-PC 215 CG12680-PC 1..215 1..215 1165 100 Plus
CG12680-PB 215 CG12680-PB 1..215 1..215 1165 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:11:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21663-PA 202 GI21663-PA 33..180 40..184 385 51.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17809-PA 206 GL17809-PA 27..172 41..184 469 57.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11754-PA 198 GA11754-PA 27..179 41..191 469 55.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12378-PA 232 GM12378-PA 18..232 1..215 1001 90.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16716-PA 202 GD16716-PA 7..202 20..215 913 92.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15787-PA 208 GJ15787-PA 38..191 39..193 383 46.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16380-PA 208 GE16380-PA 1..192 1..193 832 80.3 Plus

IP04222.hyp Sequence

Translation from 98 to 745

> IP04222.hyp
MELAGIRYGFSLWLLLLHFSCILAIIDHTKCKECEQYKYKLPERCKYLVE
DIHVFERKCGGTYPLMAFTKYRDTFVKTGEPYSLYMPSSLDHVLLLMKDS
ALQSCARIQVGDTNTFFCLDDSTNETIKLDVAHMYCFPFHIQLPDDLMQE
CLIENEMTNGFLNDILRTRRGIIHYTFGSSRGHRLNCGYLLPNLLLLVPH
LLPSMMSRKFLCELP*

IP04222.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12680-PC 215 CG12680-PC 1..215 1..215 1165 100 Plus
CG12680-PB 215 CG12680-PB 1..215 1..215 1165 100 Plus