Clone IP04226 Report

Search the DGRC for IP04226

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:26
Vector:pOT2
Associated Gene/TranscriptCG12784-RA
Protein status:IP04226.pep: gold
Preliminary Size:450
Sequenced Size:429

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12784 2005-01-01 Successful iPCR screen
CG12784 2008-04-29 Release 5.5 accounting
CG12784 2008-08-15 Release 5.9 accounting
CG12784 2008-12-18 5.12 accounting

Clone Sequence Records

IP04226.complete Sequence

429 bp (429 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023684

> IP04226.complete
TCAAGATAAAATCAACACACACGAAGAAATGGATTTCGGTGAAAACGTGT
TTGACCGTTTGGATGCGTGGACTAAAAGTGAAGTGAAGCCCGGTGAAATG
GGACGCATCTTGGCCGTTCTTCTGACCCTGATAGTGATCAGCTTTGCCAT
TGTCGTTGTGGCTCGCATCCTGGTATCTCTGGCCATACCAACATTGGTTA
TTGTGGCACTTTTGATGGCATACCGTTTCGTCACTCTTTCGGAAATGAAA
GATGGTCTCATGGCTGTGCCCGATATTCTAACATCGTGTACGAACTTTAT
ATCTGGCCTTTTTTGCCAGTTGAAGGCAAAGTAAAATTCTTGTAAATTGT
TTATATATTATATATATATTGGATACTCTTCTGCTATTCATAAAGCGTCG
CTTTAATATACAAAAAAAAAAAAAAAAAA

IP04226.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-RA 450 CG12784-RA 27..440 1..414 2070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11587754..11588164 1..411 2055 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15763141..15763554 1..414 2070 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15503972..15504385 1..414 2070 100 Plus
Blast to na_te.dros performed 2019-03-15 17:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
transib3 2883 transib3 TRANSIB3 2883bp 22..79 309..370 111 73.4 Plus
transib2 2844 transib2 TRANSIB2 2844bp 2260..2303 48..93 108 73.9 Plus

IP04226.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:44:31 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11587754..11588164 1..411 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:21 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 1..306 29..334 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:13 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 1..306 29..334 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:44:43 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 1..306 29..334 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:14:45 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 1..306 29..334 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:32 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 1..306 29..334 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:42:34 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 27..437 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:13 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 27..437 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:44:43 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 27..437 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:14:45 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 27..437 1..411 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:32 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
CG12784-RA 27..437 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:31 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15763141..15763551 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:31 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15763141..15763551 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:31 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15763141..15763551 1..411 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:44:43 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11588863..11589273 1..411 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:56 Download gff for IP04226.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15503972..15504382 1..411 100   Plus

IP04226.hyp Sequence

Translation from 0 to 333

> IP04226.hyp
QDKINTHEEMDFGENVFDRLDAWTKSEVKPGEMGRILAVLLTLIVISFAI
VVVARILVSLAIPTLVIVALLMAYRFVTLSEMKDGLMAVPDILTSCTNFI
SGLFCQLKAK*

IP04226.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:24:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 101 CG12784-PA 1..101 10..110 494 100 Plus

IP04226.pep Sequence

Translation from 28 to 333

> IP04226.pep
MDFGENVFDRLDAWTKSEVKPGEMGRILAVLLTLIVISFAIVVVARILVS
LAIPTLVIVALLMAYRFVTLSEMKDGLMAVPDILTSCTNFISGLFCQLKA
K*

IP04226.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19947-PA 109 GF19947-PA 16..109 9..101 179 39.4 Plus
Dana\GF18536-PA 121 GF18536-PA 10..84 3..76 142 40 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16945-PA 97 GG16945-PA 1..97 1..97 398 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12784-PA 101 CG12784-PA 1..101 1..101 494 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24253-PA 101 GM24253-PA 1..101 1..101 423 83.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:55:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19042-PA 101 GD19042-PA 1..101 1..101 425 82.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:55:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24332-PA 101 GE24332-PA 1..101 1..101 385 71.3 Plus