IP04226.complete Sequence
429 bp (429 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023684
> IP04226.complete
TCAAGATAAAATCAACACACACGAAGAAATGGATTTCGGTGAAAACGTGT
TTGACCGTTTGGATGCGTGGACTAAAAGTGAAGTGAAGCCCGGTGAAATG
GGACGCATCTTGGCCGTTCTTCTGACCCTGATAGTGATCAGCTTTGCCAT
TGTCGTTGTGGCTCGCATCCTGGTATCTCTGGCCATACCAACATTGGTTA
TTGTGGCACTTTTGATGGCATACCGTTTCGTCACTCTTTCGGAAATGAAA
GATGGTCTCATGGCTGTGCCCGATATTCTAACATCGTGTACGAACTTTAT
ATCTGGCCTTTTTTGCCAGTTGAAGGCAAAGTAAAATTCTTGTAAATTGT
TTATATATTATATATATATTGGATACTCTTCTGCTATTCATAAAGCGTCG
CTTTAATATACAAAAAAAAAAAAAAAAAA
IP04226.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:44:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12784-RA | 450 | CG12784-RA | 27..440 | 1..414 | 2070 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:43:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 11587754..11588164 | 1..411 | 2055 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:43:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 15763141..15763554 | 1..414 | 2070 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 15503972..15504385 | 1..414 | 2070 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 17:43:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
transib3 | 2883 | transib3 TRANSIB3 2883bp | 22..79 | 309..370 | 111 | 73.4 | Plus |
transib2 | 2844 | transib2 TRANSIB2 2844bp | 2260..2303 | 48..93 | 108 | 73.9 | Plus |
IP04226.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:44:31 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 11587754..11588164 | 1..411 | 94 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:21 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 1..306 | 29..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:13 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 1..306 | 29..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:44:43 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 1..306 | 29..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:14:45 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 1..306 | 29..334 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:45:32 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 1..306 | 29..334 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:42:34 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 27..437 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:13 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 27..437 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:44:43 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 27..437 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:14:45 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 27..437 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:45:32 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12784-RA | 27..437 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:31 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 15763141..15763551 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:31 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 15763141..15763551 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:44:31 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 15763141..15763551 | 1..411 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:44:43 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 11588863..11589273 | 1..411 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:56 Download gff for
IP04226.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 15503972..15504382 | 1..411 | 100 | | Plus |
IP04226.hyp Sequence
Translation from 0 to 333
> IP04226.hyp
QDKINTHEEMDFGENVFDRLDAWTKSEVKPGEMGRILAVLLTLIVISFAI
VVVARILVSLAIPTLVIVALLMAYRFVTLSEMKDGLMAVPDILTSCTNFI
SGLFCQLKAK*
IP04226.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:24:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12784-PA | 101 | CG12784-PA | 1..101 | 10..110 | 494 | 100 | Plus |
IP04226.pep Sequence
Translation from 28 to 333
> IP04226.pep
MDFGENVFDRLDAWTKSEVKPGEMGRILAVLLTLIVISFAIVVVARILVS
LAIPTLVIVALLMAYRFVTLSEMKDGLMAVPDILTSCTNFISGLFCQLKA
K*
IP04226.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:55:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19947-PA | 109 | GF19947-PA | 16..109 | 9..101 | 179 | 39.4 | Plus |
Dana\GF18536-PA | 121 | GF18536-PA | 10..84 | 3..76 | 142 | 40 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:55:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16945-PA | 97 | GG16945-PA | 1..97 | 1..97 | 398 | 79.4 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12784-PA | 101 | CG12784-PA | 1..101 | 1..101 | 494 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:55:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM24253-PA | 101 | GM24253-PA | 1..101 | 1..101 | 423 | 83.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:55:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD19042-PA | 101 | GD19042-PA | 1..101 | 1..101 | 425 | 82.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:55:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE24332-PA | 101 | GE24332-PA | 1..101 | 1..101 | 385 | 71.3 | Plus |