Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP04228.complete Sequence
595 bp (595 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022964.1
> IP04228.complete
AAATAATCGGCGGTCTGCAAGTTACTCTGCGATTTTGGAAACATGTGGAA
GCTGGACACCAAAGGAGGAATCATCTGCTCGGGCTGCCTGTCCATAGCCT
TTGCCATAACCTATCTGGTTTTGATGGACGATTACTTCTGGAAATATGGA
CTCTACGAGATGGGAATACACATTTCGGCGCTGCAGATCTTGGGAAGCGT
GGTCCTCATCGTTGGAGCCATAAAGCAAAAGCACAAGTTCTTCGTGCCGT
GGATGATAACCACAGGATTCTTTTTATACCTGATGGTGAACCTGTTCATT
TCACTGATAGTCCAGGGCACAGCTTGGATCTTCGGACCATTGATGGTCGT
TCCGTTCACAGCCTATCTGGGCTGCGCCCTGTACTCGGTGCAGAAGGCCT
TCGACAGGATGCGCAAGGAGGAGCCACCGGCATATGCCAGCTTGTCCGAC
AAGAAGGAGTTCATCAATCACATATAGATACATATATAAGCAATTTCAAT
ACAAACAAAAAAAAGATTAAAGGTAGATCAGATAGCTGGAAAATAAAAGC
TCATTTTAAGTGCTATTCAAACGAAACAAAAAAAAAAAAAAAAAA
IP04228.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:51:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12825.b | 2521 | CG12825.b | 1888..2467 | 1..580 | 2900 | 100 | Plus |
CG12825.c | 1536 | CG12825.c | 903..1482 | 1..580 | 2900 | 100 | Plus |
CG12825.d | 1034 | CG12825.d | 401..980 | 1..580 | 2900 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:44:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 3677091..3677309 | 359..577 | 1095 | 100 | Plus |
chr2R | 21145070 | chr2R | 3676535..3676679 | 1..145 | 725 | 100 | Plus |
chr2R | 21145070 | chr2R | 3676891..3677033 | 219..361 | 685 | 98.6 | Plus |
chr2R | 21145070 | chr2R | 3676742..3676821 | 146..225 | 400 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:44:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 7789770..7789991 | 359..580 | 1110 | 100 | Plus |
2R | 25286936 | 2R | 7789214..7789358 | 1..145 | 725 | 100 | Plus |
2R | 25286936 | 2R | 7789570..7789712 | 219..361 | 700 | 99.3 | Plus |
2R | 25286936 | 2R | 7789421..7789500 | 146..225 | 400 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 7790969..7791190 | 359..580 | 1110 | 100 | Plus |
2R | 25260384 | 2R | 7790413..7790557 | 1..145 | 725 | 100 | Plus |
2R | 25260384 | 2R | 7790769..7790911 | 219..361 | 700 | 99.3 | Plus |
2R | 25260384 | 2R | 7790620..7790699 | 146..225 | 400 | 100 | Plus |
2R | 25260384 | 2R | 7792102..7792135 | 386..419 | 140 | 94.1 | Plus |
Blast to na_te.dros performed on 2019-03-16 07:44:37 has no hits.
IP04228.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:45:36 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 3676535..3676679 | 1..145 | 100 | -> | Plus |
chr2R | 3676742..3676821 | 146..225 | 100 | -> | Plus |
chr2R | 3676898..3677033 | 226..361 | 99 | -> | Plus |
chr2R | 3677094..3677309 | 362..577 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:22 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 43..477 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:02 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 43..477 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:54 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 43..477 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:54 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 43..477 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:51 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 43..477 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:40 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..577 | 1..577 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:02 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..577 | 1..577 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:54 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 9..585 | 1..577 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:55 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..577 | 1..577 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:51 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 9..585 | 1..577 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:36 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7789214..7789358 | 1..145 | 100 | -> | Plus |
2R | 7789421..7789500 | 146..225 | 100 | -> | Plus |
2R | 7789577..7789712 | 226..361 | 100 | -> | Plus |
2R | 7789773..7789988 | 362..577 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:36 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7789214..7789358 | 1..145 | 100 | -> | Plus |
2R | 7789421..7789500 | 146..225 | 100 | -> | Plus |
2R | 7789577..7789712 | 226..361 | 100 | -> | Plus |
2R | 7789773..7789988 | 362..577 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:36 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7789214..7789358 | 1..145 | 100 | -> | Plus |
2R | 7789421..7789500 | 146..225 | 100 | -> | Plus |
2R | 7789577..7789712 | 226..361 | 100 | -> | Plus |
2R | 7789773..7789988 | 362..577 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:54 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 3676719..3676863 | 1..145 | 100 | -> | Plus |
arm_2R | 3676926..3677005 | 146..225 | 100 | -> | Plus |
arm_2R | 3677082..3677217 | 226..361 | 100 | -> | Plus |
arm_2R | 3677278..3677493 | 362..577 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:25 Download gff for
IP04228.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7790972..7791187 | 362..577 | 100 | | Plus |
2R | 7790413..7790557 | 1..145 | 100 | -> | Plus |
2R | 7790620..7790699 | 146..225 | 100 | -> | Plus |
2R | 7790776..7790911 | 226..361 | 100 | -> | Plus |
IP04228.hyp Sequence
Translation from 2 to 575
> IP04228.hyp
IIGGLQVTLRFWKHVEAGHQRRNHLLGLPVHSLCHNLSGFDGRLLLEIWT
LRDGNTHFGAADLGKRGPHRWSHKAKAQVLRAVDDNHRILFIPDGEPVHF
TDSPGHSLDLRTIDGRSVHSLSGLRPVLGAEGLRQDAQGGATGICQLVRQ
EGVHQSHIDTYISNFNTNKKKIKGRSDSWKIKAHFKCYSNE
Sequence IP04228.hyp has no blast hits.
IP04228.pep Sequence
Translation from 42 to 476
> IP04228.pep
MWKLDTKGGIICSGCLSIAFAITYLVLMDDYFWKYGLYEMGIHISALQIL
GSVVLIVGAIKQKHKFFVPWMITTGFFLYLMVNLFISLIVQGTAWIFGPL
MVVPFTAYLGCALYSVQKAFDRMRKEEPPAYASLSDKKEFINHI*
IP04228.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13201-PA | 144 | GF13201-PA | 1..144 | 1..144 | 565 | 75 | Plus |
Dana\GF13202-PA | 72 | GF13202-PA | 34..72 | 106..144 | 152 | 71.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:06:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23302-PA | 138 | GG23302-PA | 1..138 | 1..144 | 544 | 74.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12825-PA | 144 | CG12825-PA | 1..144 | 1..144 | 761 | 100 | Plus |
CG12824-PB | 142 | CG12824-PB | 1..142 | 1..144 | 327 | 49 | Plus |
CG12824-PA | 87 | CG12824-PA | 1..62 | 1..64 | 151 | 50 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:06:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10838-PA | 142 | GL10838-PA | 1..142 | 1..144 | 457 | 61.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:06:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA11836-PA | 142 | GA11836-PA | 1..142 | 1..144 | 456 | 61.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20980-PA | 144 | GM20980-PA | 1..144 | 1..144 | 682 | 90.3 | Plus |
Dsec\GM20981-PA | 109 | GM20981-PA | 1..91 | 1..88 | 149 | 40.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10508-PA | 144 | GD10508-PA | 1..144 | 1..144 | 681 | 88.9 | Plus |
Dsim\GD15357-PA | 142 | GD15357-PA | 1..142 | 1..144 | 331 | 50.7 | Plus |
Dsim\GD10509-PA | 147 | GD10509-PA | 1..147 | 1..144 | 240 | 40.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:06:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK21717-PA | 144 | GK21717-PA | 1..144 | 1..144 | 312 | 45.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:06:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19148-PA | 144 | GE19148-PA | 1..144 | 1..144 | 651 | 84.7 | Plus |