Clone IP04228 Report

Search the DGRC for IP04228

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:28
Vector:pOT2
Associated Gene/TranscriptCG12825-RA
Protein status:IP04228.pep: gold
Preliminary Size:435
Sequenced Size:595

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12825 2005-01-01 Successful iPCR screen
CG12825 2008-04-29 Release 5.5 accounting
CG12825 2008-08-15 Release 5.9 accounting
CG12825 2008-12-18 5.12 accounting

Clone Sequence Records

IP04228.complete Sequence

595 bp (595 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022964.1

> IP04228.complete
AAATAATCGGCGGTCTGCAAGTTACTCTGCGATTTTGGAAACATGTGGAA
GCTGGACACCAAAGGAGGAATCATCTGCTCGGGCTGCCTGTCCATAGCCT
TTGCCATAACCTATCTGGTTTTGATGGACGATTACTTCTGGAAATATGGA
CTCTACGAGATGGGAATACACATTTCGGCGCTGCAGATCTTGGGAAGCGT
GGTCCTCATCGTTGGAGCCATAAAGCAAAAGCACAAGTTCTTCGTGCCGT
GGATGATAACCACAGGATTCTTTTTATACCTGATGGTGAACCTGTTCATT
TCACTGATAGTCCAGGGCACAGCTTGGATCTTCGGACCATTGATGGTCGT
TCCGTTCACAGCCTATCTGGGCTGCGCCCTGTACTCGGTGCAGAAGGCCT
TCGACAGGATGCGCAAGGAGGAGCCACCGGCATATGCCAGCTTGTCCGAC
AAGAAGGAGTTCATCAATCACATATAGATACATATATAAGCAATTTCAAT
ACAAACAAAAAAAAGATTAAAGGTAGATCAGATAGCTGGAAAATAAAAGC
TCATTTTAAGTGCTATTCAAACGAAACAAAAAAAAAAAAAAAAAA

IP04228.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825.b 2521 CG12825.b 1888..2467 1..580 2900 100 Plus
CG12825.c 1536 CG12825.c 903..1482 1..580 2900 100 Plus
CG12825.d 1034 CG12825.d 401..980 1..580 2900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3677091..3677309 359..577 1095 100 Plus
chr2R 21145070 chr2R 3676535..3676679 1..145 725 100 Plus
chr2R 21145070 chr2R 3676891..3677033 219..361 685 98.6 Plus
chr2R 21145070 chr2R 3676742..3676821 146..225 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7789770..7789991 359..580 1110 100 Plus
2R 25286936 2R 7789214..7789358 1..145 725 100 Plus
2R 25286936 2R 7789570..7789712 219..361 700 99.3 Plus
2R 25286936 2R 7789421..7789500 146..225 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7790969..7791190 359..580 1110 100 Plus
2R 25260384 2R 7790413..7790557 1..145 725 100 Plus
2R 25260384 2R 7790769..7790911 219..361 700 99.3 Plus
2R 25260384 2R 7790620..7790699 146..225 400 100 Plus
2R 25260384 2R 7792102..7792135 386..419 140 94.1 Plus
Blast to na_te.dros performed on 2019-03-16 07:44:37 has no hits.

IP04228.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:45:36 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3676535..3676679 1..145 100 -> Plus
chr2R 3676742..3676821 146..225 100 -> Plus
chr2R 3676898..3677033 226..361 99 -> Plus
chr2R 3677094..3677309 362..577 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:22 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 43..477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:02 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 43..477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:54 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 43..477 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:54 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 43..477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:37:51 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 43..477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:40 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..577 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:02 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..577 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:54 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 9..585 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:55 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..577 1..577 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:37:51 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 9..585 1..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:36 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789214..7789358 1..145 100 -> Plus
2R 7789421..7789500 146..225 100 -> Plus
2R 7789577..7789712 226..361 100 -> Plus
2R 7789773..7789988 362..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:36 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789214..7789358 1..145 100 -> Plus
2R 7789421..7789500 146..225 100 -> Plus
2R 7789577..7789712 226..361 100 -> Plus
2R 7789773..7789988 362..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:45:36 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789214..7789358 1..145 100 -> Plus
2R 7789421..7789500 146..225 100 -> Plus
2R 7789577..7789712 226..361 100 -> Plus
2R 7789773..7789988 362..577 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:54 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3676719..3676863 1..145 100 -> Plus
arm_2R 3676926..3677005 146..225 100 -> Plus
arm_2R 3677082..3677217 226..361 100 -> Plus
arm_2R 3677278..3677493 362..577 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:25 Download gff for IP04228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7790972..7791187 362..577 100   Plus
2R 7790413..7790557 1..145 100 -> Plus
2R 7790620..7790699 146..225 100 -> Plus
2R 7790776..7790911 226..361 100 -> Plus

IP04228.hyp Sequence

Translation from 2 to 575

> IP04228.hyp
IIGGLQVTLRFWKHVEAGHQRRNHLLGLPVHSLCHNLSGFDGRLLLEIWT
LRDGNTHFGAADLGKRGPHRWSHKAKAQVLRAVDDNHRILFIPDGEPVHF
TDSPGHSLDLRTIDGRSVHSLSGLRPVLGAEGLRQDAQGGATGICQLVRQ
EGVHQSHIDTYISNFNTNKKKIKGRSDSWKIKAHFKCYSNE
Sequence IP04228.hyp has no blast hits.

IP04228.pep Sequence

Translation from 42 to 476

> IP04228.pep
MWKLDTKGGIICSGCLSIAFAITYLVLMDDYFWKYGLYEMGIHISALQIL
GSVVLIVGAIKQKHKFFVPWMITTGFFLYLMVNLFISLIVQGTAWIFGPL
MVVPFTAYLGCALYSVQKAFDRMRKEEPPAYASLSDKKEFINHI*

IP04228.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13201-PA 144 GF13201-PA 1..144 1..144 565 75 Plus
Dana\GF13202-PA 72 GF13202-PA 34..72 106..144 152 71.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:06:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23302-PA 138 GG23302-PA 1..138 1..144 544 74.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-PA 144 CG12825-PA 1..144 1..144 761 100 Plus
CG12824-PB 142 CG12824-PB 1..142 1..144 327 49 Plus
CG12824-PA 87 CG12824-PA 1..62 1..64 151 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:06:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10838-PA 142 GL10838-PA 1..142 1..144 457 61.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11836-PA 142 GA11836-PA 1..142 1..144 456 61.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20980-PA 144 GM20980-PA 1..144 1..144 682 90.3 Plus
Dsec\GM20981-PA 109 GM20981-PA 1..91 1..88 149 40.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10508-PA 144 GD10508-PA 1..144 1..144 681 88.9 Plus
Dsim\GD15357-PA 142 GD15357-PA 1..142 1..144 331 50.7 Plus
Dsim\GD10509-PA 147 GD10509-PA 1..147 1..144 240 40.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21717-PA 144 GK21717-PA 1..144 1..144 312 45.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19148-PA 144 GE19148-PA 1..144 1..144 651 84.7 Plus