BDGP Sequence Production Resources |
Search the DGRC for IP04230
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 42 |
Well: | 30 |
Vector: | pOT2 |
Associated Gene/Transcript | CG12868-RB |
Protein status: | IP04230.pep: gold |
Preliminary Size: | 492 |
Sequenced Size: | 736 |
Gene | Date | Evidence |
---|---|---|
CG12868 | 2005-01-01 | Successful iPCR screen |
CG12868 | 2008-04-29 | Release 5.5 accounting |
736 bp (736 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022965
> IP04230.complete GAAATCGTAAACAAAACGAAACAAACTTTATACAAATCAGTTGAAATCGT ATTTGTTGGGTATTTAATAAGAGTGCGTAGGAAGTTAACACGCATTCAGA AGTCAGAGAAGCAAGAGTCACCTCGTTATTAAAATATGACAACGAATTCA GTAACTGATAAGAACACGGAAGGAGATTACAACCTGGATGAGGAAATCGA CAGCCATTTGAGAAAATTGTTCTGTCTAAAACCAAAAGCTGAAACACCCA AACTCAATCCCTACATAGTAGAATTCTTTGGAGTTCTTAGCTTGACAGAT CTCCGTGCCCCACAAAGAAAACTATGGGTCATATATCACGCCAAGCAGCC TGATCTGGACAAGACCGTTGATGAGATCCACGAGAAGTATGGCAAGAAGA ATATGTTTGATCTGTACCGCACACCAGTTTTCAGTGGAGTTGCTCTGCGG GACAGTGTGAGAAAGCACTTCTCGAACCTAAAGTGGTTTACGACGGGAAA TCTCCTGGAAGCCCCACCTAAAAGCCACTTCAACGACGAGCGAGTGGTGA AAACCATCACGGATCTGCATCATCTGGAACACCAGAGACTATATAATTAT GTGATGGTGAAGAATATGTGGTCTATGCGGTATCGCTAAACTAACCTGTG ATTTAGGATTAAATTTGTATATGACTATCTAAAAGCAAGAATAATAAATT GTACTATTACAAAATCCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
invader2 | 5124 | invader2 INVADER2 5124bp | 4478..4552 | 131..203 | 109 | 62.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10491861..10492408 | 170..717 | 100 | <- | Minus |
chr2R | 10492470..10492638 | 1..169 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RA | 22..492 | 169..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RB | 1..504 | 136..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RB | 1..504 | 136..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RA | 22..492 | 169..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RB | 1..504 | 136..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RA | 22..492 | 169..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RB | 1..717 | 1..717 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RB | 1..679 | 39..717 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RA | 22..492 | 169..639 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12868-RB | 1..679 | 39..717 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14604558..14605105 | 170..717 | 100 | <- | Minus |
2R | 14605167..14605335 | 1..169 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14604558..14605105 | 170..717 | 100 | <- | Minus |
2R | 14605167..14605335 | 1..169 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14604558..14605105 | 170..717 | 100 | <- | Minus |
2R | 14605167..14605335 | 1..169 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10492063..10492610 | 170..717 | 100 | <- | Minus |
arm_2R | 10492672..10492840 | 1..169 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14605757..14606304 | 170..717 | 100 | <- | Minus |
2R | 14606366..14606534 | 1..169 | 100 | Minus |
Translation from 135 to 638
> IP04230.pep MTTNSVTDKNTEGDYNLDEEIDSHLRKLFCLKPKAETPKLNPYIVEFFGV LSLTDLRAPQRKLWVIYHAKQPDLDKTVDEIHEKYGKKNMFDLYRTPVFS GVALRDSVRKHFSNLKWFTTGNLLEAPPKSHFNDERVVKTITDLHHLEHQ RLYNYVMVKNMWSMRYR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13527-PA | 168 | GF13527-PA | 14..167 | 13..166 | 652 | 75.3 | Plus |
Dana\GF13526-PA | 176 | GF13526-PA | 18..163 | 16..160 | 430 | 53.4 | Plus |
Dana\GF19839-PA | 159 | GF19839-PA | 1..146 | 21..166 | 315 | 39 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22414-PA | 163 | GG22414-PA | 2..163 | 6..167 | 768 | 87 | Plus |
Dere\GG22413-PA | 160 | GG22413-PA | 1..150 | 17..166 | 342 | 39.3 | Plus |
Dere\GG16565-PA | 133 | GG16565-PA | 1..120 | 19..160 | 298 | 39.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21116-PA | 156 | GH21116-PA | 3..148 | 11..159 | 366 | 45 | Plus |
Dgri\GH21117-PA | 155 | GH21117-PA | 2..149 | 11..161 | 360 | 46.4 | Plus |
Dgri\GH21115-PA | 150 | GH21115-PA | 6..150 | 16..160 | 349 | 44.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12868-PB | 167 | CG12868-PB | 1..167 | 1..167 | 900 | 100 | Plus |
CG33468-PA | 172 | CG33468-PA | 1..159 | 1..160 | 405 | 47.5 | Plus |
CG33469-PB | 160 | CG33469-PB | 1..150 | 17..166 | 349 | 39.3 | Plus |
CG33469-PA | 160 | CG33469-PA | 1..150 | 17..166 | 349 | 39.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18721-PA | 141 | GI18721-PA | 1..140 | 28..167 | 420 | 52.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10638-PA | 158 | GL10638-PA | 8..155 | 18..165 | 583 | 71.6 | Plus |
Dper\GL10639-PA | 127 | GL10639-PA | 21..121 | 16..116 | 267 | 47.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11869-PA | 138 | GA11869-PA | 1..135 | 31..165 | 556 | 74.1 | Plus |
Dpse\GA24429-PA | 231 | GA24429-PA | 96..225 | 33..162 | 551 | 74.6 | Plus |
Dpse\GA24428-PA | 178 | GA24428-PA | 21..166 | 16..161 | 390 | 46.6 | Plus |
Dpse\GA24429-PA | 231 | GA24429-PA | 6..130 | 34..155 | 279 | 47.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20202-PA | 163 | GM20202-PA | 2..163 | 6..167 | 792 | 89.5 | Plus |
Dsec\GM20200-PA | 172 | GM20200-PA | 1..155 | 1..156 | 416 | 48.1 | Plus |
Dsec\GM20201-PA | 160 | GM20201-PA | 1..150 | 17..166 | 336 | 39.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25671-PA | 172 | GD25671-PA | 1..159 | 1..160 | 424 | 47.5 | Plus |
Dsim\GD25672-PA | 160 | GD25672-PA | 1..150 | 17..166 | 358 | 40.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21739-PA | 141 | GJ21739-PA | 1..139 | 28..166 | 417 | 55.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15731-PA | 137 | GK15731-PA | 1..132 | 31..162 | 461 | 57.6 | Plus |
Dwil\GK15732-PA | 148 | GK15732-PA | 1..143 | 25..167 | 396 | 47.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12303-PA | 163 | GE12303-PA | 2..161 | 6..165 | 746 | 85 | Plus |
Dyak\GE12301-PA | 172 | GE12301-PA | 1..165 | 1..166 | 450 | 48.8 | Plus |
Dyak\GE12302-PA | 156 | GE12302-PA | 1..146 | 21..166 | 336 | 39.7 | Plus |
Translation from 135 to 638
> IP04230.hyp MTTNSVTDKNTEGDYNLDEEIDSHLRKLFCLKPKAETPKLNPYIVEFFGV LSLTDLRAPQRKLWVIYHAKQPDLDKTVDEIHEKYGKKNMFDLYRTPVFS GVALRDSVRKHFSNLKWFTTGNLLEAPPKSHFNDERVVKTITDLHHLEHQ RLYNYVMVKNMWSMRYR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12868-PB | 167 | CG12868-PB | 1..167 | 1..167 | 900 | 100 | Plus |
CG33468-PA | 172 | CG33468-PA | 1..159 | 1..160 | 405 | 47.5 | Plus |
CG33469-PB | 160 | CG33469-PB | 1..150 | 17..166 | 349 | 39.3 | Plus |
CG33469-PA | 160 | CG33469-PA | 1..150 | 17..166 | 349 | 39.3 | Plus |