Clone IP04230 Report

Search the DGRC for IP04230

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:30
Vector:pOT2
Associated Gene/TranscriptCG12868-RB
Protein status:IP04230.pep: gold
Preliminary Size:492
Sequenced Size:736

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12868 2005-01-01 Successful iPCR screen
CG12868 2008-04-29 Release 5.5 accounting

Clone Sequence Records

IP04230.complete Sequence

736 bp (736 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022965

> IP04230.complete
GAAATCGTAAACAAAACGAAACAAACTTTATACAAATCAGTTGAAATCGT
ATTTGTTGGGTATTTAATAAGAGTGCGTAGGAAGTTAACACGCATTCAGA
AGTCAGAGAAGCAAGAGTCACCTCGTTATTAAAATATGACAACGAATTCA
GTAACTGATAAGAACACGGAAGGAGATTACAACCTGGATGAGGAAATCGA
CAGCCATTTGAGAAAATTGTTCTGTCTAAAACCAAAAGCTGAAACACCCA
AACTCAATCCCTACATAGTAGAATTCTTTGGAGTTCTTAGCTTGACAGAT
CTCCGTGCCCCACAAAGAAAACTATGGGTCATATATCACGCCAAGCAGCC
TGATCTGGACAAGACCGTTGATGAGATCCACGAGAAGTATGGCAAGAAGA
ATATGTTTGATCTGTACCGCACACCAGTTTTCAGTGGAGTTGCTCTGCGG
GACAGTGTGAGAAAGCACTTCTCGAACCTAAAGTGGTTTACGACGGGAAA
TCTCCTGGAAGCCCCACCTAAAAGCCACTTCAACGACGAGCGAGTGGTGA
AAACCATCACGGATCTGCATCATCTGGAACACCAGAGACTATATAATTAT
GTGATGGTGAAGAATATGTGGTCTATGCGGTATCGCTAAACTAACCTGTG
ATTTAGGATTAAATTTGTATATGACTATCTAAAAGCAAGAATAATAAATT
GTACTATTACAAAATCCAAAAAAAAAAAAAAAAAAA

IP04230.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG12868-RB 951 CG12868-RB 125..842 1..718 3590 100 Plus
CG12868.a 806 CG12868.a 3..717 1..718 3520 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:12:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10491861..10492409 717..169 2745 100 Minus
chr2R 21145070 chr2R 10492470..10492638 169..1 845 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14604557..14605106 718..169 2750 100 Minus
2R 25286936 2R 14605167..14605335 169..1 845 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14605756..14606305 718..169 2750 100 Minus
2R 25260384 2R 14606366..14606534 169..1 845 100 Minus
Blast to na_te.dros performed 2019-03-16 02:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
invader2 5124 invader2 INVADER2 5124bp 4478..4552 131..203 109 62.7 Plus

IP04230.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:13:25 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10491861..10492408 170..717 100 <- Minus
chr2R 10492470..10492638 1..169 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:23 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RA 22..492 169..639 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:23:03 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RB 1..504 136..639 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:17:24 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RB 1..504 136..639 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:55 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RA 22..492 169..639 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:01:39 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RB 1..504 136..639 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:42 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RA 22..492 169..639 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:23:03 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RB 1..717 1..717 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:17:24 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RB 1..679 39..717 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:56 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RA 22..492 169..639 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:01:39 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
CG12868-RB 1..679 39..717 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:13:25 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14604558..14605105 170..717 100 <- Minus
2R 14605167..14605335 1..169 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:13:25 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14604558..14605105 170..717 100 <- Minus
2R 14605167..14605335 1..169 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:13:25 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14604558..14605105 170..717 100 <- Minus
2R 14605167..14605335 1..169 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:17:24 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10492063..10492610 170..717 100 <- Minus
arm_2R 10492672..10492840 1..169 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:26 Download gff for IP04230.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14605757..14606304 170..717 100 <- Minus
2R 14606366..14606534 1..169 100   Minus

IP04230.pep Sequence

Translation from 135 to 638

> IP04230.pep
MTTNSVTDKNTEGDYNLDEEIDSHLRKLFCLKPKAETPKLNPYIVEFFGV
LSLTDLRAPQRKLWVIYHAKQPDLDKTVDEIHEKYGKKNMFDLYRTPVFS
GVALRDSVRKHFSNLKWFTTGNLLEAPPKSHFNDERVVKTITDLHHLEHQ
RLYNYVMVKNMWSMRYR*

IP04230.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:58:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13527-PA 168 GF13527-PA 14..167 13..166 652 75.3 Plus
Dana\GF13526-PA 176 GF13526-PA 18..163 16..160 430 53.4 Plus
Dana\GF19839-PA 159 GF19839-PA 1..146 21..166 315 39 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22414-PA 163 GG22414-PA 2..163 6..167 768 87 Plus
Dere\GG22413-PA 160 GG22413-PA 1..150 17..166 342 39.3 Plus
Dere\GG16565-PA 133 GG16565-PA 1..120 19..160 298 39.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:58:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21116-PA 156 GH21116-PA 3..148 11..159 366 45 Plus
Dgri\GH21117-PA 155 GH21117-PA 2..149 11..161 360 46.4 Plus
Dgri\GH21115-PA 150 GH21115-PA 6..150 16..160 349 44.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12868-PB 167 CG12868-PB 1..167 1..167 900 100 Plus
CG33468-PA 172 CG33468-PA 1..159 1..160 405 47.5 Plus
CG33469-PB 160 CG33469-PB 1..150 17..166 349 39.3 Plus
CG33469-PA 160 CG33469-PA 1..150 17..166 349 39.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18721-PA 141 GI18721-PA 1..140 28..167 420 52.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10638-PA 158 GL10638-PA 8..155 18..165 583 71.6 Plus
Dper\GL10639-PA 127 GL10639-PA 21..121 16..116 267 47.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11869-PA 138 GA11869-PA 1..135 31..165 556 74.1 Plus
Dpse\GA24429-PA 231 GA24429-PA 96..225 33..162 551 74.6 Plus
Dpse\GA24428-PA 178 GA24428-PA 21..166 16..161 390 46.6 Plus
Dpse\GA24429-PA 231 GA24429-PA 6..130 34..155 279 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20202-PA 163 GM20202-PA 2..163 6..167 792 89.5 Plus
Dsec\GM20200-PA 172 GM20200-PA 1..155 1..156 416 48.1 Plus
Dsec\GM20201-PA 160 GM20201-PA 1..150 17..166 336 39.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25671-PA 172 GD25671-PA 1..159 1..160 424 47.5 Plus
Dsim\GD25672-PA 160 GD25672-PA 1..150 17..166 358 40.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21739-PA 141 GJ21739-PA 1..139 28..166 417 55.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15731-PA 137 GK15731-PA 1..132 31..162 461 57.6 Plus
Dwil\GK15732-PA 148 GK15732-PA 1..143 25..167 396 47.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12303-PA 163 GE12303-PA 2..161 6..165 746 85 Plus
Dyak\GE12301-PA 172 GE12301-PA 1..165 1..166 450 48.8 Plus
Dyak\GE12302-PA 156 GE12302-PA 1..146 21..166 336 39.7 Plus

IP04230.hyp Sequence

Translation from 135 to 638

> IP04230.hyp
MTTNSVTDKNTEGDYNLDEEIDSHLRKLFCLKPKAETPKLNPYIVEFFGV
LSLTDLRAPQRKLWVIYHAKQPDLDKTVDEIHEKYGKKNMFDLYRTPVFS
GVALRDSVRKHFSNLKWFTTGNLLEAPPKSHFNDERVVKTITDLHHLEHQ
RLYNYVMVKNMWSMRYR*

IP04230.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:24:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG12868-PB 167 CG12868-PB 1..167 1..167 900 100 Plus
CG33468-PA 172 CG33468-PA 1..159 1..160 405 47.5 Plus
CG33469-PB 160 CG33469-PB 1..150 17..166 349 39.3 Plus
CG33469-PA 160 CG33469-PA 1..150 17..166 349 39.3 Plus