Clone IP04252 Report

Search the DGRC for IP04252

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:52
Vector:pOT2
Associated Gene/TranscriptCG13477-RA
Protein status:IP04252.pep: gold
Preliminary Size:503
Sequenced Size:629

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13477 2005-01-01 Successful iPCR screen
CG13477 2008-04-29 Release 5.5 accounting
CG13477 2008-08-15 Release 5.9 accounting
CG13477 2008-12-18 5.12 accounting

Clone Sequence Records

IP04252.complete Sequence

629 bp (629 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023681

> IP04252.complete
TTTGCACTTAAGTCTGTTCTAGTTCACAGCTCCTGAATAACTATTGAAAT
TTCTGAAATATATTTTTTTTGTCAAAATGTCGGACGACGGATCTGATATA
TTCCAAGACCTTGAAAGCTACGAGCCCTATACAGAAGGTAGCCAAAACAA
TAGTGACGAAGCAACTGCAGTGGGGCCTCTCGATACCTCTGAGGACGCTC
GCTTCTCCGAGCAGGTATTCTCGAACATTCAGGAGCGTCTGAACCGAATC
ATTAATCGCATTAGCATGGCCAACTCTGCCGTGGTCCAGATGAAGAGGAA
GCTCCATGCTCGAATTCCATCCGTACCTGTTGGCGAAAACGCCGACCAGT
TGGCTGGAGGCGATAATCCAATGCGATTTGAAAACGTCGAACAAGAAAAC
GAAACCACCAACCAATGATATAAGAACATTTTTATATTTCTCATTTTCAA
AAATGTATAAATTTATTGTATTTATTTATTGTTATTGTTATTGAAGCCCA
TTTAACAAATCACAAACAGACCCGAGTTAATTGTTAAAAAATTATGCATT
AACACAAGCCAAGGATTCGAAAACTAAGCGCATATAATAAACTGAGCAAT
GAGCAAAAGCAAAAAAAAAAAAAAAAAAA

IP04252.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13477-RA 503 CG13477-RA 1..503 16..518 2515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14681485..14682094 1..610 3035 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14691353..14691964 1..612 3060 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14684453..14685064 1..612 3060 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:40:44 has no hits.

IP04252.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:41:32 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14681485..14682094 1..610 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:27 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:31 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:36:39 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:30 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:57 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..342 77..418 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:25 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..503 16..518 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:31 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..503 16..518 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:36:39 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 7..616 1..610 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:31 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 1..503 16..518 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:57 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
CG13477-RA 7..616 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:32 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14691353..14691962 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:32 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14691353..14691962 1..610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:32 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14691353..14691962 1..610 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:36:39 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14684453..14685062 1..610 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:50 Download gff for IP04252.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14684453..14685062 1..610 100   Plus

IP04252.pep Sequence

Translation from 76 to 417

> IP04252.pep
MSDDGSDIFQDLESYEPYTEGSQNNSDEATAVGPLDTSEDARFSEQVFSN
IQERLNRIINRISMANSAVVQMKRKLHARIPSVPVGENADQLAGGDNPMR
FENVEQENETTNQ*

IP04252.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24614-PA 111 GF24614-PA 1..100 1..100 206 45.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15692-PA 113 GG15692-PA 1..113 1..113 461 77.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
goddard-PA 113 CG13477-PA 1..113 1..113 575 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25475-PA 113 GM25475-PA 1..113 1..113 567 95.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:47:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14498-PA 113 GD14498-PA 1..113 1..113 567 95.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22023-PA 113 GE22023-PA 1..113 1..113 451 76.1 Plus

IP04252.hyp Sequence

Translation from 76 to 417

> IP04252.hyp
MSDDGSDIFQDLESYEPYTEGSQNNSDEATAVGPLDTSEDARFSEQVFSN
IQERLNRIINRISMANSAVVQMKRKLHARIPSVPVGENADQLAGGDNPMR
FENVEQENETTNQ*

IP04252.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13477-PA 113 CG13477-PA 1..113 1..113 575 100 Plus