IP04252.complete Sequence
629 bp (629 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023681
> IP04252.complete
TTTGCACTTAAGTCTGTTCTAGTTCACAGCTCCTGAATAACTATTGAAAT
TTCTGAAATATATTTTTTTTGTCAAAATGTCGGACGACGGATCTGATATA
TTCCAAGACCTTGAAAGCTACGAGCCCTATACAGAAGGTAGCCAAAACAA
TAGTGACGAAGCAACTGCAGTGGGGCCTCTCGATACCTCTGAGGACGCTC
GCTTCTCCGAGCAGGTATTCTCGAACATTCAGGAGCGTCTGAACCGAATC
ATTAATCGCATTAGCATGGCCAACTCTGCCGTGGTCCAGATGAAGAGGAA
GCTCCATGCTCGAATTCCATCCGTACCTGTTGGCGAAAACGCCGACCAGT
TGGCTGGAGGCGATAATCCAATGCGATTTGAAAACGTCGAACAAGAAAAC
GAAACCACCAACCAATGATATAAGAACATTTTTATATTTCTCATTTTCAA
AAATGTATAAATTTATTGTATTTATTTATTGTTATTGTTATTGAAGCCCA
TTTAACAAATCACAAACAGACCCGAGTTAATTGTTAAAAAATTATGCATT
AACACAAGCCAAGGATTCGAAAACTAAGCGCATATAATAAACTGAGCAAT
GAGCAAAAGCAAAAAAAAAAAAAAAAAAA
IP04252.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:50:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13477-RA | 503 | CG13477-RA | 1..503 | 16..518 | 2515 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:40:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 14681485..14682094 | 1..610 | 3035 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:40:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 14691353..14691964 | 1..612 | 3060 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 14684453..14685064 | 1..612 | 3060 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 15:40:44 has no hits.
IP04252.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:41:32 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 14681485..14682094 | 1..610 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:27 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..342 | 77..418 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:31 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..342 | 77..418 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:36:39 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..342 | 77..418 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:30 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..342 | 77..418 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:57 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..342 | 77..418 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:25 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..503 | 16..518 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:31 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..503 | 16..518 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:36:39 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 7..616 | 1..610 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:31 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 1..503 | 16..518 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:57 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13477-RA | 7..616 | 1..610 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:32 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14691353..14691962 | 1..610 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:32 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14691353..14691962 | 1..610 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:32 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14691353..14691962 | 1..610 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:36:39 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 14684453..14685062 | 1..610 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:50 Download gff for
IP04252.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 14684453..14685062 | 1..610 | 100 | | Plus |
IP04252.pep Sequence
Translation from 76 to 417
> IP04252.pep
MSDDGSDIFQDLESYEPYTEGSQNNSDEATAVGPLDTSEDARFSEQVFSN
IQERLNRIINRISMANSAVVQMKRKLHARIPSVPVGENADQLAGGDNPMR
FENVEQENETTNQ*
IP04252.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:47:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24614-PA | 111 | GF24614-PA | 1..100 | 1..100 | 206 | 45.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:47:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15692-PA | 113 | GG15692-PA | 1..113 | 1..113 | 461 | 77.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
goddard-PA | 113 | CG13477-PA | 1..113 | 1..113 | 575 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:47:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25475-PA | 113 | GM25475-PA | 1..113 | 1..113 | 567 | 95.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:47:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14498-PA | 113 | GD14498-PA | 1..113 | 1..113 | 567 | 95.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:47:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE22023-PA | 113 | GE22023-PA | 1..113 | 1..113 | 451 | 76.1 | Plus |
IP04252.hyp Sequence
Translation from 76 to 417
> IP04252.hyp
MSDDGSDIFQDLESYEPYTEGSQNNSDEATAVGPLDTSEDARFSEQVFSN
IQERLNRIINRISMANSAVVQMKRKLHARIPSVPVGENADQLAGGDNPMR
FENVEQENETTNQ*
IP04252.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13477-PA | 113 | CG13477-PA | 1..113 | 1..113 | 575 | 100 | Plus |