Clone IP04259 Report

Search the DGRC for IP04259

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:59
Vector:pOT2
Associated Gene/TranscriptCG13641-RA
Protein status:IP04259.pep: gold
Preliminary Size:429
Sequenced Size:608

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13641 2005-01-01 Successful iPCR screen
CG13641 2008-04-29 Release 5.5 accounting
CG13641 2008-08-15 Release 5.9 accounting
CG13641 2008-12-18 5.12 accounting

Clone Sequence Records

IP04259.complete Sequence

608 bp (608 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023682

> IP04259.complete
CCATGTGCTGCTGCTGGCTATAAAAGCCGCATGGACATTGGGACTATCAG
CAAAATTGCTCTACATATCCCAAGATGCAGTTGTTGGCTGCGATTCTAGT
GCTAATCCTGGCCAGCTTGGCCCACGGTAGACCCACTTTCGATAAGATTG
CGGAGCTTCTGTTCGGCGACCCAAATCATTATCCGCCAGCAAGGCCAGTT
GATCCACAGCTACATCCTGGACCAGGTCCACTCATCCAGGAGGGCTACGA
GCAGGGCTACGACTATCACTATGGTGGAGGCTACGGCTACGGTGGTAGCC
ACCAGCAGACGCATCCAGGTGGCTATGCCTATTACCCACCACGACCGGTT
CCGGCAGCAAATGACTACTATCCACCACCTTGGTCAGTGCGTCCTTCGCC
TGGATACTACTCTCAGCCGTCTCATCCTGCCAGTGTCCATTATCCGCACA
AGAATCAGGATCTTTACGGAGGTGGAGGTGGTTACAAGCAGCGGGGTTAC
TAACGTTCATCCGTCAGATACCCCAGTCTCATCCAATCATGTGCTGTCTC
ATTTGTTTATGTGTAATTTATTAAAATTTCGTTTATTTCCAAAAAAAAAA
AAAAAAAA

IP04259.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13641-RA 687 CG13641-RA 1..592 1..592 2960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20687377..20687966 590..1 2950 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:04:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24864189..24864780 592..1 2960 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24605020..24605611 592..1 2960 100 Minus
Blast to na_te.dros performed on 2019-03-15 20:04:42 has no hits.

IP04259.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:05:32 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20687377..20687966 1..590 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:29 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..429 75..503 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:55:32 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..429 75..503 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:02:23 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..429 75..503 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:36:12 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..429 75..503 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:00 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..429 75..503 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:31:57 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:55:32 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:02:23 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..542 49..590 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:36:12 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:00 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
CG13641-RA 1..542 49..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:32 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24864191..24864780 1..590 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:32 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24864191..24864780 1..590 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:32 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24864191..24864780 1..590 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:02:23 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20689913..20690502 1..590 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:14:48 Download gff for IP04259.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24605022..24605611 1..590 100   Minus

IP04259.pep Sequence

Translation from 74 to 502

> IP04259.pep
MQLLAAILVLILASLAHGRPTFDKIAELLFGDPNHYPPARPVDPQLHPGP
GPLIQEGYEQGYDYHYGGGYGYGGSHQQTHPGGYAYYPPRPVPAANDYYP
PPWSVRPSPGYYSQPSHPASVHYPHKNQDLYGGGGGYKQRGY*

IP04259.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12308-PA 139 GG12308-PA 14..139 14..142 166 73.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG13641-PA 142 CG13641-PA 1..142 1..142 818 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:21:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23450-PA 138 GM23450-PA 1..138 1..142 383 76.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22755-PA 134 GK22755-PA 9..110 19..132 141 47.9 Plus

IP04259.hyp Sequence

Translation from 74 to 502

> IP04259.hyp
MQLLAAILVLILASLAHGRPTFDKIAELLFGDPNHYPPARPVDPQLHPGP
GPLIQEGYEQGYDYHYGGGYGYGGSHQQTHPGGYAYYPPRPVPAANDYYP
PPWSVRPSPGYYSQPSHPASVHYPHKNQDLYGGGGGYKQRGY*

IP04259.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13641-PA 142 CG13641-PA 1..142 1..142 818 100 Plus