Clone IP04269 Report

Search the DGRC for IP04269

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:69
Vector:pOT2
Associated Gene/TranscriptCG13898-RA
Protein status:IP04269.pep: gold
Preliminary Size:483
Sequenced Size:600

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13898 2005-01-01 Successful iPCR screen
CG13898 2008-04-29 Release 5.5 accounting
CG13898 2008-08-15 Release 5.9 accounting
CG13898 2008-12-18 5.12 accounting

Clone Sequence Records

IP04269.complete Sequence

600 bp (600 high quality bases) assembled on 2005-03-01

GenBank Submission: BT022948

> IP04269.complete
AAGCTGAAAACATCAAATAACGTACACATCTTCGATACACTACATAGATC
AAAATGGAATCACAAGACTACATATTGGCGAATGACGATCTTCAAGACAT
TTGCGAAGCCTTCGAGCTCTGTGATCCTGAGAAGACTGGAAGAATCAGAG
CAGACGATTTGGGAGAAGTGATGCGCACTCTCGGCCAGAATCACACCGAG
TCGGAAATCTACAGATATTCCGAGGGACTCGAGGGAGACGTCAACGGGTA
CATACAACTCACTGATTTCATCGATTTGATGACCAAAATCTACAGCGCGA
TGGGCAGCAGTGACTATTTGAAGGCAGCATATAATGCCTTCGATTTTGAT
AAGGACGGTTTGGTAACATATGGCGAGCTACGTCACGTTTTCATCAATCT
TGGCGAAAAAATATCCGACGAAGAGTTCAATGAAGTGTTTCGTCAGGCTG
ATGTTGATGGCGATGGCGTTATTAACTTCCGTGATTTTTGTACAGCCTAT
AGATCCTAAATAATCATATCCGCAAGCCTACATACATATATATGTGTGCT
GACTTGGTTGGTATTTGTACATTTAATAAAAAAAAAAAAAAAAAAAAAAA

IP04269.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13898-RA 625 CG13898-RA 26..606 1..581 2905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 803189..803765 577..1 2795 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 803446..804026 581..1 2905 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 803446..804026 581..1 2905 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:43:45 has no hits.

IP04269.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:44:24 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 803189..803765 1..577 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:33 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 1..456 54..509 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:15 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 1..456 54..509 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:15 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 1..456 54..509 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:46 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 1..456 54..509 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:13 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 1..456 54..509 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:38 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 26..602 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:15 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 26..602 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:15 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 26..602 1..577 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:46 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 1..483 27..509 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:13 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
CG13898-RA 26..602 1..577 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:24 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
3L 803450..804026 1..577 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:24 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
3L 803450..804026 1..577 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:24 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
3L 803450..804026 1..577 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:15 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 803450..804026 1..577 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:46:48 Download gff for IP04269.complete
Subject Subject Range Query Range Percent Splice Strand
3L 803450..804026 1..577 100   Minus

IP04269.pep Sequence

Translation from 53 to 508

> IP04269.pep
MESQDYILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTES
EIYRYSEGLEGDVNGYIQLTDFIDLMTKIYSAMGSSDYLKAAYNAFDFDK
DGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGDGVINFRDFCTAYR
S*

IP04269.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13648-PA 151 GF13648-PA 1..150 1..150 380 48 Plus
Dana\GF12835-PA 149 GF12835-PA 5..148 8..151 293 39.6 Plus
Dana\GF16772-PA 148 GF16772-PA 4..142 8..146 283 41.7 Plus
Dana\GF16771-PA 165 GF16771-PA 21..159 8..146 211 31.7 Plus
Dana\GF13649-PA 155 GF13649-PA 13..150 8..145 199 32.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14636-PA 151 GG14636-PA 1..151 1..151 628 78.8 Plus
Dere\GG20265-PA 149 GG20265-PA 5..148 8..151 293 39.6 Plus
Dere\GG11425-PA 148 GG11425-PA 4..142 8..146 278 40.3 Plus
Dere\GG23318-PA 147 GG23318-PA 4..147 8..151 249 38.9 Plus
Dere\GG23316-PA 148 GG23316-PA 12..142 16..146 193 30.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:20:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21304-PA 151 GH21304-PA 1..150 1..150 282 38 Plus
Dgri\GH23405-PA 151 GH23405-PA 17..145 18..146 250 39.5 Plus
Dgri\GH16787-PA 149 GH16787-PA 3..141 8..146 197 31.7 Plus
Dgri\GH10976-PA 190 GH10976-PA 41..181 6..146 197 34 Plus
Dgri\GH24922-PA 158 GH24922-PA 18..157 11..151 174 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13898-PA 151 CG13898-PA 1..151 1..151 794 100 Plus
Cam-PD 149 CG8472-PD 5..148 8..151 297 39.6 Plus
Cam-PC 149 CG8472-PC 5..148 8..151 297 39.6 Plus
Cam-PE 149 CG8472-PE 5..148 8..151 297 39.6 Plus
Cam-PB 149 CG8472-PB 5..148 8..151 297 39.6 Plus
Cam-PA 149 CG8472-PA 5..148 8..151 297 39.6 Plus
Acam-PB 148 CG17769-PB 4..141 8..145 291 41.3 Plus
Acam-PA 148 CG17769-PA 4..141 8..145 291 41.3 Plus
CG30378-PA 148 CG30378-PA 5..148 8..151 269 40.3 Plus
CG31960-PA 148 CG31960-PA 16..141 20..145 211 34.1 Plus
CG17770-PA 164 CG17770-PA 20..157 8..145 206 29.7 Plus
CG17493-PD 182 CG17493-PD 42..172 15..145 204 35.1 Plus
CG17493-PC 182 CG17493-PC 42..172 15..145 204 35.1 Plus
CG17493-PB 182 CG17493-PB 42..172 15..145 204 35.1 Plus
CG11638-PA 387 CG11638-PA 206..354 8..148 202 30.9 Plus
azot-PA 148 CG11165-PA 12..141 16..145 200 30 Plus
CG13526-PA 154 CG13526-PA 9..146 8..145 191 29 Plus
CG31802-PA 186 CG31802-PA 46..176 15..145 190 32.8 Plus
Mlc-c-PA 147 CG3201-PA 7..140 11..145 182 32.4 Plus
Mlc-c-PB 153 CG3201-PB 15..146 13..145 179 32.1 Plus
CG5024-PB 165 CG5024-PB 19..160 6..147 173 28.2 Plus
CG5024-PA 165 CG5024-PA 19..160 6..147 173 28.2 Plus
sqh-PE 174 CG3595-PE 38..160 18..145 165 26.6 Plus
sqh-PD 174 CG3595-PD 38..160 18..145 165 26.6 Plus
sqh-PC 174 CG3595-PC 38..160 18..145 165 26.6 Plus
sqh-PB 174 CG3595-PB 38..160 18..145 165 26.6 Plus
sqh-PA 174 CG3595-PA 38..160 18..145 165 26.6 Plus
CG17272-PA 149 CG17272-PA 9..137 12..145 153 29.6 Plus
Eip63F-1-PC 181 CG15855-PC 24..176 12..145 152 25.5 Plus
Eip63F-1-PA 193 CG15855-PA 36..188 12..145 152 25.5 Plus
TpnC41C-PB 154 CG2981-PB 16..145 19..145 151 26.2 Plus
TpnC41C-PA 154 CG2981-PA 16..145 19..145 151 26.2 Plus
TpnC73F-PC 155 CG7930-PC 1..148 1..145 149 23 Plus
TpnC73F-PA 155 CG7930-PA 1..148 1..145 149 23 Plus
Eip63F-1-PD 166 CG15855-PD 10..161 13..145 149 25.7 Plus
TpnC25D-PC 149 CG6514-PC 1..142 8..145 146 23.9 Plus
TpnC25D-PA 149 CG6514-PA 1..142 8..145 146 23.9 Plus
Eip63F-1-PB 161 CG15855-PB 11..156 19..145 143 26 Plus
TpnC25D-PB 143 CG6514-PB 6..136 18..145 141 23.7 Plus
Mlc2-PA 222 CG2184-PA 71..202 7..141 139 25 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20594-PA 149 GI20594-PA 5..148 8..151 293 39.6 Plus
Dmoj\GI19794-PA 151 GI19794-PA 1..151 1..151 284 36.4 Plus
Dmoj\GI10339-PA 149 GI10339-PA 5..143 8..146 268 39.6 Plus
Dmoj\GI10340-PA 150 GI10340-PA 6..143 8..145 216 36.2 Plus
Dmoj\GI20846-PA 184 GI20846-PA 43..180 14..151 188 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11704-PA 151 GL11704-PA 1..151 1..151 313 39.1 Plus
Dper\GL10814-PA 149 GL10814-PA 5..148 8..151 293 39.6 Plus
Dper\GL21535-PA 148 GL21535-PA 4..142 8..146 272 41 Plus
Dper\GL21536-PA 148 GL21536-PA 4..142 8..146 263 38.8 Plus
Dper\GL11703-PA 149 GL11703-PA 6..148 8..150 247 37.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24240-PA 151 GA24240-PA 1..151 1..151 315 39.1 Plus
Dpse\GA24499-PA 149 GA24499-PA 5..148 8..151 293 39.6 Plus
Dpse\GA14657-PA 148 GA14657-PA 4..142 8..146 272 41 Plus
Dpse\GA26322-PA 148 GA26322-PA 4..142 8..146 263 38.8 Plus
Dpse\GA24239-PA 149 GA24239-PA 6..149 8..151 251 37.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14251-PA 151 GM14251-PA 1..151 1..151 746 95.4 Plus
Dsec\GM21351-PA 149 GM21351-PA 5..148 8..151 293 39.6 Plus
Dsec\GM10265-PA 148 GM10265-PA 4..142 8..146 283 41 Plus
Dsec\GM20995-PA 148 GM20995-PA 5..148 8..151 262 40.3 Plus
Dsec\GM10264-PA 164 GM10264-PA 20..158 8..146 212 30.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13508-PA 151 GD13508-PA 1..151 1..151 738 93.4 Plus
Dsim\GD10849-PA 149 GD10849-PA 5..148 8..151 293 39.6 Plus
Dsim\GD21235-PA 148 GD21235-PA 4..142 8..146 283 41 Plus
Dsim\GD10525-PA 148 GD10525-PA 5..148 8..151 265 41 Plus
Dsim\GD21234-PA 164 GD21234-PA 20..158 8..146 211 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10193-PA 151 GJ10193-PA 2..145 3..146 258 39.6 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 1..112 40..151 250 41.1 Plus
Dvir\GJ15117-PA 152 GJ15117-PA 9..152 8..151 246 35.4 Plus
Dvir\GJ11809-PA 147 GJ11809-PA 3..141 8..146 212 33.8 Plus
Dvir\GJ19846-PA 184 GJ19846-PA 44..180 15..151 202 35 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22183-PA 149 GK22183-PA 5..148 8..151 293 39.6 Plus
Dwil\GK18988-PA 148 GK18988-PA 4..142 8..146 280 40.3 Plus
Dwil\GK21975-PA 147 GK21975-PA 4..146 8..150 258 35.7 Plus
Dwil\GK19414-PA 148 GK19414-PA 4..142 8..146 222 35.3 Plus
Dwil\GK19415-PA 112 GK19415-PA 1..112 40..151 213 40.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20994-PA 151 GE20994-PA 1..151 1..151 646 80.8 Plus
Dyak\Cam-PA 149 GE12425-PA 5..148 8..151 293 39.6 Plus
Dyak\GE23620-PA 148 GE23620-PA 4..142 8..146 274 39.6 Plus
Dyak\GE19162-PA 147 GE19162-PA 4..147 8..151 241 38.2 Plus
Dyak\GE18259-PA 148 GE18259-PA 12..142 16..146 215 34.4 Plus

IP04269.hyp Sequence

Translation from 53 to 508

> IP04269.hyp
MESQDYILANDDLQDICEAFELCDPEKTGRIRADDLGEVMRTLGQNHTES
EIYRYSEGLEGDVNGYIQLTDFIDLMTKIYSAMGSSDYLKAAYNAFDFDK
DGLVTYGELRHVFINLGEKISDEEFNEVFRQADVDGDGVINFRDFCTAYR
S*

IP04269.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13898-PA 151 CG13898-PA 1..151 1..151 794 100 Plus
Cam-PD 149 CG8472-PD 5..148 8..151 297 39.6 Plus
Cam-PC 149 CG8472-PC 5..148 8..151 297 39.6 Plus
Cam-PE 149 CG8472-PE 5..148 8..151 297 39.6 Plus
Cam-PB 149 CG8472-PB 5..148 8..151 297 39.6 Plus