BDGP Sequence Production Resources |
Search the DGRC for IP04278
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 42 |
Well: | 78 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14075-RA |
Protein status: | IP04278.pep: gold |
Preliminary Size: | 468 |
Sequenced Size: | 696 |
Gene | Date | Evidence |
---|---|---|
CG14075 | 2005-01-01 | Successful iPCR screen |
CG14075 | 2008-04-29 | Release 5.5 accounting |
CG14075 | 2008-08-15 | Release 5.9 accounting |
CG14075 | 2008-12-18 | 5.12 accounting |
696 bp (696 high quality bases) assembled on 2006-01-24
GenBank Submission: BT024406
> IP04278.complete CGGCCAGTGCACGGAAAAAGTACTCGGAATTCCAGCTGGAATCGGTTGGT AGAATGGCCCCACTGCATCTGCTGCTCCACTGTGCCACCACTCTGCTGAT TGCCAACGCCCTGGTACTGAGTCCCCAATTACTGGGTGCAGAAAATGAGG CCAAATCGAAAGTCGGTTTCCCCATCGACCTGGACGACGGCGTAGATGGG GTGGACCTGCCACTGGAGGTGGAACAGGATGTGGCCGGGGACCAGTCCGC CGGCAGGTCCCTGCACTCCATGCCGCCCGACTGGCTGACCTTCGACGAAC CCACTCCGGCCACGAAGCATCGGTCTGGCCACAAGCCGCAGATCATCCTG AAGCACCCGACCAGCGGATTCCACAAGCTTTCCGCCCACGGACATCGCAC CTGCCACGTGGAAATCGTCAGCAAGGTGCAAGGTATCTGCCAGCCGATGC CCATTGGCAGCGCTTGCGTCTCGGATGACTACATGGACCTCTACACCGAT GCCAACTGCTCATCTCAATAGAAGGGTTCACTTGCGGCCTGATTGATGGA TTGATTGATTGCTTCATTGATTGTCCGTGTGTGTGTGAGCTCAGATTTTG TGCGAGGAGGAGTACGACTACCTGGTGCCCAATTTCAGCAAAGCTTGTAT AAATAAATCCACTTAATAAATTTTAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14075-RA | 674 | CG14075-RA | 1..674 | 1..674 | 3370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 18974558..18975231 | 1..674 | 3370 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 18984961..18985635 | 1..675 | 3375 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 18978061..18978735 | 1..675 | 3375 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18974558..18975231 | 1..674 | 94 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..468 | 54..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..468 | 54..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..468 | 54..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..468 | 54..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..468 | 54..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..468 | 54..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..674 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..674 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..468 | 54..521 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14075-RA | 1..674 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18984961..18985634 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18984961..18985634 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18984961..18985634 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18978061..18978734 | 1..674 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18978061..18978734 | 1..674 | 100 | Plus |
Translation from 2 to 520
> IP04278.hyp ASARKKYSEFQLESVGRMAPLHLLLHCATTLLIANALVLSPQLLGAENEA KSKVGFPIDLDDGVDGVDLPLEVEQDVAGDQSAGRSLHSMPPDWLTFDEP TPATKHRSGHKPQIILKHPTSGFHKLSAHGHRTCHVEIVSKVQGICQPMP IGSACVSDDYMDLYTDANCSSQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14075-PA | 155 | CG14075-PA | 1..155 | 18..172 | 829 | 100 | Plus |
Translation from 53 to 520
> IP04278.pep MAPLHLLLHCATTLLIANALVLSPQLLGAENEAKSKVGFPIDLDDGVDGV DLPLEVEQDVAGDQSAGRSLHSMPPDWLTFDEPTPATKHRSGHKPQIILK HPTSGFHKLSAHGHRTCHVEIVSKVQGICQPMPIGSACVSDDYMDLYTDA NCSSQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23656-PA | 152 | GF23656-PA | 17..152 | 16..155 | 393 | 61.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG16018-PA | 155 | GG16018-PA | 1..155 | 1..155 | 712 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14608-PA | 170 | GH14608-PA | 1..169 | 1..154 | 215 | 44.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14075-PA | 155 | CG14075-PA | 1..155 | 1..155 | 829 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13496-PA | 165 | GI13496-PA | 1..164 | 1..154 | 213 | 43.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21734-PA | 175 | GL21734-PA | 16..175 | 16..155 | 418 | 56.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12747-PA | 175 | GA12747-PA | 1..175 | 1..155 | 481 | 58.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM15008-PA | 155 | GM15008-PA | 1..155 | 1..155 | 791 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14785-PA | 155 | GD14785-PA | 1..155 | 1..155 | 791 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11857-PA | 210 | GJ11857-PA | 63..209 | 16..154 | 218 | 40 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10396-PA | 178 | GK10396-PA | 1..177 | 1..154 | 261 | 39.2 | Plus |