Clone IP04278 Report

Search the DGRC for IP04278

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:78
Vector:pOT2
Associated Gene/TranscriptCG14075-RA
Protein status:IP04278.pep: gold
Preliminary Size:468
Sequenced Size:696

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14075 2005-01-01 Successful iPCR screen
CG14075 2008-04-29 Release 5.5 accounting
CG14075 2008-08-15 Release 5.9 accounting
CG14075 2008-12-18 5.12 accounting

Clone Sequence Records

IP04278.complete Sequence

696 bp (696 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024406

> IP04278.complete
CGGCCAGTGCACGGAAAAAGTACTCGGAATTCCAGCTGGAATCGGTTGGT
AGAATGGCCCCACTGCATCTGCTGCTCCACTGTGCCACCACTCTGCTGAT
TGCCAACGCCCTGGTACTGAGTCCCCAATTACTGGGTGCAGAAAATGAGG
CCAAATCGAAAGTCGGTTTCCCCATCGACCTGGACGACGGCGTAGATGGG
GTGGACCTGCCACTGGAGGTGGAACAGGATGTGGCCGGGGACCAGTCCGC
CGGCAGGTCCCTGCACTCCATGCCGCCCGACTGGCTGACCTTCGACGAAC
CCACTCCGGCCACGAAGCATCGGTCTGGCCACAAGCCGCAGATCATCCTG
AAGCACCCGACCAGCGGATTCCACAAGCTTTCCGCCCACGGACATCGCAC
CTGCCACGTGGAAATCGTCAGCAAGGTGCAAGGTATCTGCCAGCCGATGC
CCATTGGCAGCGCTTGCGTCTCGGATGACTACATGGACCTCTACACCGAT
GCCAACTGCTCATCTCAATAGAAGGGTTCACTTGCGGCCTGATTGATGGA
TTGATTGATTGCTTCATTGATTGTCCGTGTGTGTGTGAGCTCAGATTTTG
TGCGAGGAGGAGTACGACTACCTGGTGCCCAATTTCAGCAAAGCTTGTAT
AAATAAATCCACTTAATAAATTTTAAAAAAAAAAAAAAAAAAAAAA

IP04278.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14075-RA 674 CG14075-RA 1..674 1..674 3370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18974558..18975231 1..674 3370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18984961..18985635 1..675 3375 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18978061..18978735 1..675 3375 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:13:52 has no hits.

IP04278.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:14:32 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18974558..18975231 1..674 94   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:36 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..468 54..521 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:05 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..468 54..521 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:58:07 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..468 54..521 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:42 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..468 54..521 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:01:06 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..468 54..521 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:31 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..468 54..521 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:04 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..674 1..674 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:58:07 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..674 1..674 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:42 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..468 54..521 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:01:06 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
CG14075-RA 1..674 1..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:32 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18984961..18985634 1..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:32 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18984961..18985634 1..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:14:32 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18984961..18985634 1..674 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:58:07 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18978061..18978734 1..674 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:38 Download gff for IP04278.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18978061..18978734 1..674 100   Plus

IP04278.hyp Sequence

Translation from 2 to 520

> IP04278.hyp
ASARKKYSEFQLESVGRMAPLHLLLHCATTLLIANALVLSPQLLGAENEA
KSKVGFPIDLDDGVDGVDLPLEVEQDVAGDQSAGRSLHSMPPDWLTFDEP
TPATKHRSGHKPQIILKHPTSGFHKLSAHGHRTCHVEIVSKVQGICQPMP
IGSACVSDDYMDLYTDANCSSQ*

IP04278.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14075-PA 155 CG14075-PA 1..155 18..172 829 100 Plus

IP04278.pep Sequence

Translation from 53 to 520

> IP04278.pep
MAPLHLLLHCATTLLIANALVLSPQLLGAENEAKSKVGFPIDLDDGVDGV
DLPLEVEQDVAGDQSAGRSLHSMPPDWLTFDEPTPATKHRSGHKPQIILK
HPTSGFHKLSAHGHRTCHVEIVSKVQGICQPMPIGSACVSDDYMDLYTDA
NCSSQ*

IP04278.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23656-PA 152 GF23656-PA 17..152 16..155 393 61.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16018-PA 155 GG16018-PA 1..155 1..155 712 94.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14608-PA 170 GH14608-PA 1..169 1..154 215 44.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG14075-PA 155 CG14075-PA 1..155 1..155 829 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13496-PA 165 GI13496-PA 1..164 1..154 213 43.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:18:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21734-PA 175 GL21734-PA 16..175 16..155 418 56.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12747-PA 175 GA12747-PA 1..175 1..155 481 58.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15008-PA 155 GM15008-PA 1..155 1..155 791 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14785-PA 155 GD14785-PA 1..155 1..155 791 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11857-PA 210 GJ11857-PA 63..209 16..154 218 40 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10396-PA 178 GK10396-PA 1..177 1..154 261 39.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23186-PA 155 GE23186-PA 1..155 1..155 787 96.1 Plus
Dyak\GE23185-PA 155 GE23185-PA 1..155 1..155 787 96.1 Plus