Clone IP04281 Report

Search the DGRC for IP04281

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:81
Vector:pOT2
Associated Gene/TranscriptCG14113-RA
Protein status:IP04281.pep: gold
Preliminary Size:436
Sequenced Size:500

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14113 2005-01-01 Successful iPCR screen
CG14113 2008-04-29 Release 5.5 accounting
CG14113 2008-08-15 Release 5.9 accounting
CG14113 2008-12-18 5.12 accounting

Clone Sequence Records

IP04281.complete Sequence

500 bp (500 high quality bases) assembled on 2005-03-01

GenBank Submission: BT022945

> IP04281.complete
AACAAACGAAAAAAAAAAAACAAAATAATAATACTGCTTAAAATCAAGAT
GTCATCCGAAGAAGAGGTATACACGGAGGAGGAGACTGATCAGGCCATGT
CCTTCATTCGTGAGCATGACCTGCCCATGTCGGAGCTGCAGTATGCACTC
AGATATGTCCGCATTCTGCGCGAAAACAAATCACTGAGCGATCAGGTTAT
GGGAATCCGTGAGCCACAGAATCCTGTTGCTGAGGTGGCGCCACCGTCAT
TCGACTGGAATGACAAGGAGAATAAAGCCGTGGCCCGGGATCCATAATTG
CATTAAATGTTTTTAAGTTTTTTTTTTATTGATTTGCGTTCTGCCTTCTG
CCCTCTAATTGTCAACGATCAAAGCGCAATTTTAATTATTCGAAAATATG
TAAACAAGTTTCGCAATAGTTGGCAATGGCTATATTAACAATTGTAATGC
AAAATTAAAGATATTTTTTCTGTGCCAGCAAAAAAAAAAAAAAAAAAAAA

IP04281.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-RA 582 CG14113-RA 70..548 1..480 2360 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13319487..13319900 65..479 2025 99.8 Plus
chr3L 24539361 chr3L 13319371..13319438 1..68 340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:22:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13329286..13329700 65..480 2030 99.8 Plus
3L 28110227 3L 13329170..13329237 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13322386..13322800 65..480 2040 99.7 Plus
3L 28103327 3L 13322270..13322337 1..68 340 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:22:19 has no hits.

IP04281.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:23:32 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13319371..13319436 1..66 100 -> Plus
chr3L 13319489..13319900 67..479 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:37 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..249 49..297 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:29 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..249 49..297 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:33 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..249 49..297 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:32 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..249 49..297 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:38:57 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..249 49..297 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:21 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..430 49..479 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:29 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..430 49..479 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:33 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 36..513 1..479 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:32 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 1..430 49..479 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:38:57 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
CG14113-RA 36..513 1..479 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:32 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13329288..13329699 67..479 99   Plus
3L 13329170..13329235 1..66 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:32 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13329288..13329699 67..479 99   Plus
3L 13329170..13329235 1..66 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:32 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13329288..13329699 67..479 99   Plus
3L 13329170..13329235 1..66 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:33 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13322270..13322335 1..66 100 -> Plus
arm_3L 13322388..13322799 67..479 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:02 Download gff for IP04281.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13322388..13322799 67..479 99   Plus
3L 13322270..13322335 1..66 100 -> Plus

IP04281.hyp Sequence

Translation from 0 to 296

> IP04281.hyp
NKRKKKNKIIILLKIKMSSEEEVYTEEETDQAMSFIREHDLPMSELQYAL
RYVRILRENKSLSDQVMGIREPQNPVAEVAPPSFDWNDKENKAVARDP*

IP04281.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-PA 82 CG14113-PA 1..82 17..98 423 100 Plus

IP04281.pep Sequence

Translation from 48 to 296

> IP04281.pep
MSSEEEVYTEEETDQAMSFIREHDLPMSELQYALRYVRILRENKSLSDQV
MGIREPQNPVAEVAPPSFDWNDKENKAVARDP*

IP04281.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15633-PA 84 GG15633-PA 14..83 13..81 242 68.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14113-PA 82 CG14113-PA 1..82 1..82 423 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25410-PA 79 GM25410-PA 14..79 13..82 265 77.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14441-PA 83 GD14441-PA 14..83 13..82 303 80 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11913-PA 95 GJ11913-PA 15..86 6..72 136 43.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19284-PA 82 GK19284-PA 4..60 8..67 146 54.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21960-PA 83 GE21960-PA 17..82 16..81 230 65.2 Plus