IP04281.complete Sequence
500 bp (500 high quality bases) assembled on 2005-03-01
GenBank Submission: BT022945
> IP04281.complete
AACAAACGAAAAAAAAAAAACAAAATAATAATACTGCTTAAAATCAAGAT
GTCATCCGAAGAAGAGGTATACACGGAGGAGGAGACTGATCAGGCCATGT
CCTTCATTCGTGAGCATGACCTGCCCATGTCGGAGCTGCAGTATGCACTC
AGATATGTCCGCATTCTGCGCGAAAACAAATCACTGAGCGATCAGGTTAT
GGGAATCCGTGAGCCACAGAATCCTGTTGCTGAGGTGGCGCCACCGTCAT
TCGACTGGAATGACAAGGAGAATAAAGCCGTGGCCCGGGATCCATAATTG
CATTAAATGTTTTTAAGTTTTTTTTTTATTGATTTGCGTTCTGCCTTCTG
CCCTCTAATTGTCAACGATCAAAGCGCAATTTTAATTATTCGAAAATATG
TAAACAAGTTTCGCAATAGTTGGCAATGGCTATATTAACAATTGTAATGC
AAAATTAAAGATATTTTTTCTGTGCCAGCAAAAAAAAAAAAAAAAAAAAA
IP04281.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:54:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14113-RA | 582 | CG14113-RA | 70..548 | 1..480 | 2360 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:22:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 13319487..13319900 | 65..479 | 2025 | 99.8 | Plus |
chr3L | 24539361 | chr3L | 13319371..13319438 | 1..68 | 340 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:22:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13329286..13329700 | 65..480 | 2030 | 99.8 | Plus |
3L | 28110227 | 3L | 13329170..13329237 | 1..68 | 340 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 13322386..13322800 | 65..480 | 2040 | 99.7 | Plus |
3L | 28103327 | 3L | 13322270..13322337 | 1..68 | 340 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 08:22:19 has no hits.
IP04281.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:23:32 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 13319371..13319436 | 1..66 | 100 | -> | Plus |
chr3L | 13319489..13319900 | 67..479 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:37 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..249 | 49..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:29 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..249 | 49..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:13:33 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..249 | 49..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:32 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..249 | 49..297 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:38:57 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..249 | 49..297 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:21 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..430 | 49..479 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:29 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..430 | 49..479 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:13:33 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 36..513 | 1..479 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:32 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 1..430 | 49..479 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:38:57 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14113-RA | 36..513 | 1..479 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:32 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13329288..13329699 | 67..479 | 99 | | Plus |
3L | 13329170..13329235 | 1..66 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:32 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13329288..13329699 | 67..479 | 99 | | Plus |
3L | 13329170..13329235 | 1..66 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:32 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13329288..13329699 | 67..479 | 99 | | Plus |
3L | 13329170..13329235 | 1..66 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:13:33 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13322270..13322335 | 1..66 | 100 | -> | Plus |
arm_3L | 13322388..13322799 | 67..479 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:02 Download gff for
IP04281.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13322388..13322799 | 67..479 | 99 | | Plus |
3L | 13322270..13322335 | 1..66 | 100 | -> | Plus |
IP04281.hyp Sequence
Translation from 0 to 296
> IP04281.hyp
NKRKKKNKIIILLKIKMSSEEEVYTEEETDQAMSFIREHDLPMSELQYAL
RYVRILRENKSLSDQVMGIREPQNPVAEVAPPSFDWNDKENKAVARDP*
IP04281.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14113-PA | 82 | CG14113-PA | 1..82 | 17..98 | 423 | 100 | Plus |
IP04281.pep Sequence
Translation from 48 to 296
> IP04281.pep
MSSEEEVYTEEETDQAMSFIREHDLPMSELQYALRYVRILRENKSLSDQV
MGIREPQNPVAEVAPPSFDWNDKENKAVARDP*
IP04281.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:18:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15633-PA | 84 | GG15633-PA | 14..83 | 13..81 | 242 | 68.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14113-PA | 82 | CG14113-PA | 1..82 | 1..82 | 423 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:18:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25410-PA | 79 | GM25410-PA | 14..79 | 13..82 | 265 | 77.1 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:18:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14441-PA | 83 | GD14441-PA | 14..83 | 13..82 | 303 | 80 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:18:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11913-PA | 95 | GJ11913-PA | 15..86 | 6..72 | 136 | 43.1 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:18:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19284-PA | 82 | GK19284-PA | 4..60 | 8..67 | 146 | 54.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:18:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21960-PA | 83 | GE21960-PA | 17..82 | 16..81 | 230 | 65.2 | Plus |