Clone IP04283 Report

Search the DGRC for IP04283

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:83
Vector:pOT2
Associated Gene/TranscriptBlos2-RA
Protein status:IP04283.pep: gold
Preliminary Size:480
Sequenced Size:664

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14145 2005-01-01 Successful iPCR screen
CG14145 2008-04-29 Release 5.5 accounting
CG14145 2008-08-15 Release 5.9 accounting
CG14145 2008-12-18 5.12 accounting

Clone Sequence Records

IP04283.complete Sequence

664 bp (664 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023680

> IP04283.complete
CTGATTGCAATTATTACTTTGTTTTTGGAAAACTAAGAAAATCGTGTTGC
AACTTCCTTGGATAGACTATGGATAAACCCACAACTAGCGCCGCTGCTGC
TGCGGCTCAGGATTCCAACCTTCTTCCGGACTCCCCACAACACGGACCAA
CGTTGTCCAGCGCCTCCAGTTTCGAGGCACTGACGCGACACGACCCCAAT
CTCAGTCGTTTGGCCACGAAAATGTTCAACAAAACGGAGGAGTACATCAC
ACACGAACTGAACGCTCCGCTGGAGGATTACAAGCTGCTGGAGGAGATGA
ACAAGGCTACGATTGCCAAGTACAAGGATATGCGGCAGATTGCCGAGAAT
CTGAATACTTCGACCAGTGAATTGAGCCTTAAGTTCCAGCAATTAGCTCC
GATGATGCAGCAAATCGATGAGATTTCCGACACCGTCGACAAATTGGAGG
CGGCGGCCTATAAACTGGACGCATACAGCATAGCCCTAGAAAATCGCGTC
AAGTGCGTGCTGCAAAGGAAATCCGGAGGCGGTCAAGTGGCACAATAAGA
CTTCTCCATTAAAAGGGCTTTATGGTACACATTTATTATATTAGATTCTA
TGTCAACCAAGTAATAGTTTAAATATAATCGCAATTATGTTAAGGAAAAA
AAAAAAAAAAAAAA

IP04283.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14145-RA 645 CG14145-RA 1..645 1..645 3180 99.5 Plus
CG32069-RA 484 CG32069-RA 379..483 647..543 525 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11052449..11053093 1..645 3150 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11061571..11062217 1..647 3190 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11054671..11055317 1..647 3190 99.5 Plus
Blast to na_te.dros performed on 2019-03-16 03:49:26 has no hits.

IP04283.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:50:22 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11052449..11053093 1..645 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:38 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14145-RA 1..480 69..548 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:14:12 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
blos2-RA 1..480 69..548 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:54 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
blos2-RA 1..480 69..548 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:58:42 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14145-RA 1..480 69..548 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:15:59 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
Blos2-RA 1..480 69..548 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:11:13 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14145-RA 1..645 1..645 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:14:12 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
blos2-RA 1..645 1..645 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:54 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
blos2-RA 1..645 1..645 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:58:42 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
CG14145-RA 1..480 69..548 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:15:59 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
Blos2-RA 1..645 1..645 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:22 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11061571..11062215 1..645 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:22 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11061571..11062215 1..645 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:22 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11061571..11062215 1..645 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:54 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11054671..11055315 1..645 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:34:11 Download gff for IP04283.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11054671..11055315 1..645 99   Plus

IP04283.hyp Sequence

Translation from 68 to 547

> IP04283.hyp
MDKPTTSAAAAAAQDSNLLPDSPQHGPTLSSASSFEALTRHDPNLSRLAT
KMFNKTEEYITHELNAPLEDYKLLEEMNKATIAKYKDMRQIAENLNTSTS
ELSLKFQQLAPMMQQIDEISDTVDKLEAAAYKLDAYSIALENRVKCVLQR
KSGGGQVAQ*

IP04283.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:43
Subject Length Description Subject Range Query Range Score Percent Strand
Blos2-PA 159 CG14145-PA 1..159 1..159 795 100 Plus

IP04283.pep Sequence

Translation from 68 to 547

> IP04283.pep
MDKPTTSAAAAAAQDSNLLPDSPQHGPTLSSASSFEALTRHDPNLSRLAT
KMFNKTEEYITHELNAPLEDYKLLEEMNKATIAKYKDMRQIAENLNTSTS
ELSLKFQQLAPMMQQIDEISDTVDKLEAAAYKLDAYSIALENRVKCVLQR
KSGGGQVAQ*

IP04283.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10627-PA 160 GF10627-PA 4..160 2..159 756 91.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:01:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15471-PA 159 GG15471-PA 1..159 1..159 822 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14927-PA 163 GH14927-PA 3..163 2..158 627 80.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Blos2-PA 159 CG14145-PA 1..159 1..159 795 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11444-PA 163 GI11444-PA 1..159 1..153 638 83.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:01:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15674-PA 164 GL15674-PA 4..159 2..153 672 86.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12787-PA 164 GA12787-PA 4..159 2..153 672 86.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25243-PA 159 GM25243-PA 1..159 1..159 828 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14276-PA 159 GD14276-PA 1..159 1..159 834 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:01:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13641-PA 164 GJ13641-PA 4..164 2..156 643 83.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11252-PA 164 GK11252-PA 4..163 2..159 618 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:01:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21780-PA 160 GE21780-PA 1..160 1..159 816 97.5 Plus