BDGP Sequence Production Resources |
Search the DGRC for IP04283
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 42 |
Well: | 83 |
Vector: | pOT2 |
Associated Gene/Transcript | Blos2-RA |
Protein status: | IP04283.pep: gold |
Preliminary Size: | 480 |
Sequenced Size: | 664 |
Gene | Date | Evidence |
---|---|---|
CG14145 | 2005-01-01 | Successful iPCR screen |
CG14145 | 2008-04-29 | Release 5.5 accounting |
CG14145 | 2008-08-15 | Release 5.9 accounting |
CG14145 | 2008-12-18 | 5.12 accounting |
664 bp (664 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023680
> IP04283.complete CTGATTGCAATTATTACTTTGTTTTTGGAAAACTAAGAAAATCGTGTTGC AACTTCCTTGGATAGACTATGGATAAACCCACAACTAGCGCCGCTGCTGC TGCGGCTCAGGATTCCAACCTTCTTCCGGACTCCCCACAACACGGACCAA CGTTGTCCAGCGCCTCCAGTTTCGAGGCACTGACGCGACACGACCCCAAT CTCAGTCGTTTGGCCACGAAAATGTTCAACAAAACGGAGGAGTACATCAC ACACGAACTGAACGCTCCGCTGGAGGATTACAAGCTGCTGGAGGAGATGA ACAAGGCTACGATTGCCAAGTACAAGGATATGCGGCAGATTGCCGAGAAT CTGAATACTTCGACCAGTGAATTGAGCCTTAAGTTCCAGCAATTAGCTCC GATGATGCAGCAAATCGATGAGATTTCCGACACCGTCGACAAATTGGAGG CGGCGGCCTATAAACTGGACGCATACAGCATAGCCCTAGAAAATCGCGTC AAGTGCGTGCTGCAAAGGAAATCCGGAGGCGGTCAAGTGGCACAATAAGA CTTCTCCATTAAAAGGGCTTTATGGTACACATTTATTATATTAGATTCTA TGTCAACCAAGTAATAGTTTAAATATAATCGCAATTATGTTAAGGAAAAA AAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 11052449..11053093 | 1..645 | 3150 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 11061571..11062217 | 1..647 | 3190 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 11054671..11055317 | 1..647 | 3190 | 99.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 11052449..11053093 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14145-RA | 1..480 | 69..548 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos2-RA | 1..480 | 69..548 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos2-RA | 1..480 | 69..548 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14145-RA | 1..480 | 69..548 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Blos2-RA | 1..480 | 69..548 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14145-RA | 1..645 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos2-RA | 1..645 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
blos2-RA | 1..645 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14145-RA | 1..480 | 69..548 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Blos2-RA | 1..645 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11061571..11062215 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11061571..11062215 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11061571..11062215 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 11054671..11055315 | 1..645 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11054671..11055315 | 1..645 | 99 | Plus |
Translation from 68 to 547
> IP04283.hyp MDKPTTSAAAAAAQDSNLLPDSPQHGPTLSSASSFEALTRHDPNLSRLAT KMFNKTEEYITHELNAPLEDYKLLEEMNKATIAKYKDMRQIAENLNTSTS ELSLKFQQLAPMMQQIDEISDTVDKLEAAAYKLDAYSIALENRVKCVLQR KSGGGQVAQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Blos2-PA | 159 | CG14145-PA | 1..159 | 1..159 | 795 | 100 | Plus |
Translation from 68 to 547
> IP04283.pep MDKPTTSAAAAAAQDSNLLPDSPQHGPTLSSASSFEALTRHDPNLSRLAT KMFNKTEEYITHELNAPLEDYKLLEEMNKATIAKYKDMRQIAENLNTSTS ELSLKFQQLAPMMQQIDEISDTVDKLEAAAYKLDAYSIALENRVKCVLQR KSGGGQVAQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10627-PA | 160 | GF10627-PA | 4..160 | 2..159 | 756 | 91.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15471-PA | 159 | GG15471-PA | 1..159 | 1..159 | 822 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14927-PA | 163 | GH14927-PA | 3..163 | 2..158 | 627 | 80.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Blos2-PA | 159 | CG14145-PA | 1..159 | 1..159 | 795 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11444-PA | 163 | GI11444-PA | 1..159 | 1..153 | 638 | 83.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15674-PA | 164 | GL15674-PA | 4..159 | 2..153 | 672 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12787-PA | 164 | GA12787-PA | 4..159 | 2..153 | 672 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25243-PA | 159 | GM25243-PA | 1..159 | 1..159 | 828 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14276-PA | 159 | GD14276-PA | 1..159 | 1..159 | 834 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13641-PA | 164 | GJ13641-PA | 4..164 | 2..156 | 643 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11252-PA | 164 | GK11252-PA | 4..163 | 2..159 | 618 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21780-PA | 160 | GE21780-PA | 1..160 | 1..159 | 816 | 97.5 | Plus |