Clone IP04289 Report

Search the DGRC for IP04289

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:42
Well:89
Vector:pOT2
Associated Gene/TranscriptCCHa1-RB
Protein status:IP04289.pep: gold
Preliminary Size:462
Sequenced Size:877

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14358 2005-01-01 Successful iPCR screen
CG14358 2008-04-29 Release 5.5 accounting
CG14358 2008-08-15 Release 5.9 accounting
CG14358 2008-12-18 5.12 accounting

Clone Sequence Records

IP04289.complete Sequence

877 bp (877 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022941

> IP04289.complete
TTGGCACCTGACTCTGATCAACAAGTGGCAAGTGGAAAGTAGAAAGTCCT
GGTATTCGGTGAAGTGTTCGGTTTCTGAAAAGTTCTCTAAAAGTTACCAA
AAGAAAATTTCAAAAGAAAATTATAACTGACGTCGGACAATTTGCGTGCA
GCTTGCGAAATAATATTTATTGAAAAATGTGGTACAGCAAGTGCAGTTGG
ACTTTGGTAGTGTTGGTGGCTCTCTTTGCTCTCGTGACAGGTTCCTGCCT
GGAATACGGACATTCGTGTTGGGGAGCTCATGGCAAGCGGTCCGGCGGGA
AGGCGGTCATAGATGCTAAACAGCATCCCTTGCCAAATTCATATGGCTTG
GATAGCGTGGTGGAGCAACTGTACAACAACAACAACAACAACCAGAACAA
CCAGGACGACGACAACAACGATGACGACAGCAACAGAAATACGAATGCGA
ATAGTGCCAACAACATACCCCTGGCTGCTCCAGCCATTATAAGTCGTCGA
GAATCGGAGGATCGGCGAATCGGTGGCCTAAAGTGGGCGCAGCTGATGCG
GCAGCACCGCTATCAATTGCGCCAGTTGCAGGATCAGCAGCAGCAGGGGC
GTGGCAGGGGCGGTCAGGGTCAGTACGATGCGGCAGCCGAGAGTTGGAGG
AAACTGCAGCAGGCTCTGCAGGCCCAAATCGATGCCGACAATGAGAACTA
CTCGGGCTACGAGCTAACGAAGTGAACATTCCGAGGCCAATTGCCAAATT
GAAATTATGCAGATAACACGCTAGCTAAGCCAGAAGAACAGAGGGAAAAG
CGAAATAAAACGATATTTATCACACGCGAGATCATTGCATGCCGGGCATC
AATTAACAAAAAAAAAAAAAAAAAAAA

IP04289.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14358-RB 905 CG14358-RB 38..905 1..868 4340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9917382..9917914 857..319 2525 98.3 Minus
chr3R 27901430 chr3R 9921462..9921703 242..1 1180 99.2 Minus
chr3R 27901430 chr3R 9918009..9918057 323..275 245 100 Minus
chr3R 27901430 chr3R 9918145..9918183 276..238 195 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14092489..14093042 872..319 2755 99.8 Minus
3R 32079331 3R 14096594..14096835 242..1 1210 100 Minus
3R 32079331 3R 14093137..14093185 323..275 245 100 Minus
3R 32079331 3R 14093273..14093311 276..238 195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13833320..13833873 872..319 2755 99.8 Minus
3R 31820162 3R 13837425..13837666 242..1 1210 100 Minus
3R 31820162 3R 13833968..13834016 323..275 245 100 Minus
3R 31820162 3R 13834104..13834142 276..238 195 100 Minus
Blast to na_te.dros performed 2019-03-15 20:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2418..2642 374..596 149 56.5 Plus

IP04289.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:19:52 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9917861..9917909 324..372 100 <- Minus
chr3R 9918009..9918055 277..323 100 <- Minus
chr3R 9918145..9918180 241..276 100 <- Minus
chr3R 9921464..9921703 1..240 99   Minus
chr3R 9917382..9917795 438..857 98 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:40 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CG14358-RB 1..549 177..725 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:22:52 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CG14358-RB 1..549 177..725 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:06:05 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CCHa1-RB 1..549 177..725 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:46 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CG14358-RB 1..549 177..725 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:33:47 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CCHa1-RB 1..549 177..725 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:27 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CG14358-RB 1..857 1..857 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:22:52 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CG14358-RB 1..857 1..857 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:06:05 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CCHa1-RB 1..857 1..857 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:46 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CG14358-RB 1..857 1..857 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:33:47 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
CCHa1-RB 1..857 1..857 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:52 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14092504..14093037 324..857 100 <- Minus
3R 14093137..14093183 277..323 100 <- Minus
3R 14093273..14093308 241..276 100 <- Minus
3R 14096596..14096835 1..240 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:52 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14092504..14093037 324..857 100 <- Minus
3R 14093137..14093183 277..323 100 <- Minus
3R 14093273..14093308 241..276 100 <- Minus
3R 14096596..14096835 1..240 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:19:52 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14092504..14093037 324..857 100 <- Minus
3R 14093137..14093183 277..323 100 <- Minus
3R 14093273..14093308 241..276 100 <- Minus
3R 14096596..14096835 1..240 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:06:05 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9918226..9918759 324..857 100 <- Minus
arm_3R 9918859..9918905 277..323 100 <- Minus
arm_3R 9918995..9919030 241..276 100 <- Minus
arm_3R 9922318..9922557 1..240 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:15 Download gff for IP04289.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13833335..13833868 324..857 100 <- Minus
3R 13833968..13834014 277..323 100 <- Minus
3R 13834104..13834139 241..276 100 <- Minus
3R 13837427..13837666 1..240 100   Minus

IP04289.pep Sequence

Translation from 176 to 724

> IP04289.pep
MWYSKCSWTLVVLVALFALVTGSCLEYGHSCWGAHGKRSGGKAVIDAKQH
PLPNSYGLDSVVEQLYNNNNNNQNNQDDDNNDDDSNRNTNANSANNIPLA
APAIISRRESEDRRIGGLKWAQLMRQHRYQLRQLQDQQQQGRGRGGQGQY
DAAAESWRKLQQALQAQIDADNENYSGYELTK*

IP04289.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18794-PA 182 GF18794-PA 1..182 1..182 409 55.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:57:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21555-PA 175 GG21555-PA 1..175 1..182 727 87.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22452-PA 180 GH22452-PA 1..146 1..164 343 51.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:33
Subject Length Description Subject Range Query Range Score Percent Strand
CCHa1-PB 182 CG14358-PB 1..182 1..182 977 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24559-PA 175 GI24559-PA 16..145 21..159 241 45.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23314-PA 216 GL23314-PA 13..174 6..160 203 45 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27219-PB 214 GA27219-PB 1..170 1..160 279 54.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25891-PA 176 GM25891-PA 1..176 1..182 634 90.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20461-PA 176 GD20461-PA 1..176 1..182 646 91.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22625-PA 175 GJ22625-PA 1..155 1..164 328 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10913-PA 173 GK10913-PA 1..155 1..164 188 49.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10066-PA 186 GE10066-PA 1..186 1..182 602 77.9 Plus

IP04289.hyp Sequence

Translation from 176 to 724

> IP04289.hyp
MWYSKCSWTLVVLVALFALVTGSCLEYGHSCWGAHGKRSGGKAVIDAKQH
PLPNSYGLDSVVEQLYNNNNNNQNNQDDDNNDDDSNRNTNANSANNIPLA
APAIISRRESEDRRIGGLKWAQLMRQHRYQLRQLQDQQQQGRGRGGQGQY
DAAAESWRKLQQALQAQIDADNENYSGYELTK*

IP04289.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:25:49
Subject Length Description Subject Range Query Range Score Percent Strand
CCHa1-PB 182 CG14358-PB 1..182 1..182 977 100 Plus