Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
IP04328.complete Sequence
585 bp (585 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022933.1
> IP04328.complete
CGGTCTGCAAGTTACTCTGCGATTTTGGAAACATGTGGAAGCTGGACACC
AAAGGAGGAATCATCTGCTCGGGCTGCCTGTCCATAGCCTTTGCCATAAC
CTATCTGGTTTTGATGGACGATTACTTCTGGAAATATGGACTCTACGAGA
TGGGAATACACATTTCGGCGCTGCAGATCTTGGGAAGCGTGGTCCTCATC
GTTGGAGCCATAAAGCAAAAGCACAAGTTCTTCGTGCCGTGGATGATAAC
CACAGGATTCTTTTTATACCTGATGGTGAACCTGTTCATTTCACTGATAG
TCCAGGGCACAGCTTGGATCTTCGGACCATTGATGGTCGTTCCGTTCACA
GCCTATCTGGGCTGCGCCCTGTACTCGGTGCAGAAGGCCTTCGACAGGAT
GCGCAAGGAGGAGCCACCGGCATATGCCAGCTTGTCCGACAAGAAGGAGT
TCATCAATCACATATAGATACATATATAAGCAATTTCAATACAAACAAAA
AAAAGATTAAAGGTAGATCAGATAGCTGGAAAATAAAAGCTCATTTTAAG
TGCTATTCAAACGAAACAAAAAAAAAAAAAAAAAA
IP04328.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:51:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12825.b | 2521 | CG12825.b | 1898..2467 | 1..570 | 2850 | 100 | Plus |
CG12825.c | 1536 | CG12825.c | 913..1482 | 1..570 | 2850 | 100 | Plus |
CG12825.d | 1034 | CG12825.d | 411..980 | 1..570 | 2850 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:37:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 3677091..3677309 | 349..567 | 1095 | 100 | Plus |
chr2R | 21145070 | chr2R | 3676891..3677033 | 209..351 | 685 | 98.6 | Plus |
chr2R | 21145070 | chr2R | 3676545..3676679 | 1..135 | 675 | 100 | Plus |
chr2R | 21145070 | chr2R | 3676742..3676821 | 136..215 | 400 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 7789770..7789991 | 349..570 | 1110 | 100 | Plus |
2R | 25286936 | 2R | 7789570..7789712 | 209..351 | 700 | 99.3 | Plus |
2R | 25286936 | 2R | 7789224..7789358 | 1..135 | 675 | 100 | Plus |
2R | 25286936 | 2R | 7789421..7789500 | 136..215 | 400 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 7790969..7791190 | 349..570 | 1110 | 100 | Plus |
2R | 25260384 | 2R | 7790769..7790911 | 209..351 | 700 | 99.3 | Plus |
2R | 25260384 | 2R | 7790423..7790557 | 1..135 | 675 | 100 | Plus |
2R | 25260384 | 2R | 7790620..7790699 | 136..215 | 400 | 100 | Plus |
2R | 25260384 | 2R | 7792102..7792135 | 376..409 | 140 | 94.1 | Plus |
Blast to na_te.dros performed on 2019-03-15 12:37:28 has no hits.
IP04328.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:38:30 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 3676545..3676679 | 1..135 | 100 | -> | Plus |
chr2R | 3676742..3676821 | 136..215 | 100 | -> | Plus |
chr2R | 3676898..3677033 | 216..351 | 99 | -> | Plus |
chr2R | 3677094..3677309 | 352..567 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:45 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 33..467 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:22:36 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 33..467 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:40 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 33..467 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:30 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 33..467 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:06:22 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 1..435 | 33..467 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:05 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 11..577 | 1..567 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:22:36 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 11..577 | 1..567 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:40 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 19..585 | 1..567 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:31 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 11..577 | 1..567 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:06:22 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12825-RA | 19..585 | 1..567 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:30 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7789773..7789988 | 352..567 | 100 | | Plus |
2R | 7789421..7789500 | 136..215 | 100 | -> | Plus |
2R | 7789577..7789712 | 216..351 | 100 | -> | Plus |
2R | 7789224..7789358 | 1..135 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:30 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7789773..7789988 | 352..567 | 100 | | Plus |
2R | 7789421..7789500 | 136..215 | 100 | -> | Plus |
2R | 7789577..7789712 | 216..351 | 100 | -> | Plus |
2R | 7789224..7789358 | 1..135 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:30 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7789773..7789988 | 352..567 | 100 | | Plus |
2R | 7789421..7789500 | 136..215 | 100 | -> | Plus |
2R | 7789577..7789712 | 216..351 | 100 | -> | Plus |
2R | 7789224..7789358 | 1..135 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:40 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 3676729..3676863 | 1..135 | 100 | -> | Plus |
arm_2R | 3676926..3677005 | 136..215 | 100 | -> | Plus |
arm_2R | 3677082..3677217 | 216..351 | 100 | -> | Plus |
arm_2R | 3677278..3677493 | 352..567 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:58 Download gff for
IP04328.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 7790972..7791187 | 352..567 | 100 | | Plus |
2R | 7790423..7790557 | 1..135 | 100 | -> | Plus |
2R | 7790620..7790699 | 136..215 | 100 | -> | Plus |
2R | 7790776..7790911 | 216..351 | 100 | -> | Plus |
IP04328.hyp Sequence
Translation from 0 to 565
> IP04328.hyp
GLQVTLRFWKHVEAGHQRRNHLLGLPVHSLCHNLSGFDGRLLLEIWTLRD
GNTHFGAADLGKRGPHRWSHKAKAQVLRAVDDNHRILFIPDGEPVHFTDS
PGHSLDLRTIDGRSVHSLSGLRPVLGAEGLRQDAQGGATGICQLVRQEGV
HQSHIDTYISNFNTNKKKIKGRSDSWKIKAHFKCYSNE
Sequence IP04328.hyp has no blast hits.
IP04328.pep Sequence
Translation from 2 to 466
> IP04328.pep
VCKLLCDFGNMWKLDTKGGIICSGCLSIAFAITYLVLMDDYFWKYGLYEM
GIHISALQILGSVVLIVGAIKQKHKFFVPWMITTGFFLYLMVNLFISLIV
QGTAWIFGPLMVVPFTAYLGCALYSVQKAFDRMRKEEPPAYASLSDKKEF
INHI*
IP04328.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF13201-PA | 144 | GF13201-PA | 1..144 | 11..154 | 566 | 75 | Plus |
Dana\GF13202-PA | 72 | GF13202-PA | 34..72 | 116..154 | 150 | 71.8 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:06:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23302-PA | 138 | GG23302-PA | 1..138 | 11..154 | 542 | 74.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12825-PA | 144 | CG12825-PA | 1..144 | 11..154 | 761 | 100 | Plus |
CG12824-PB | 142 | CG12824-PB | 1..142 | 11..154 | 327 | 49 | Plus |
CG12824-PA | 87 | CG12824-PA | 1..62 | 11..74 | 151 | 50 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:06:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL10838-PA | 142 | GL10838-PA | 1..142 | 11..154 | 456 | 61.1 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:06:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA11836-PA | 142 | GA11836-PA | 1..142 | 11..154 | 454 | 61.1 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20980-PA | 144 | GM20980-PA | 1..144 | 11..154 | 680 | 90.3 | Plus |
Dsec\GM20981-PA | 109 | GM20981-PA | 1..91 | 11..98 | 149 | 40.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10508-PA | 144 | GD10508-PA | 1..144 | 11..154 | 679 | 88.9 | Plus |
Dsim\GD15357-PA | 142 | GD15357-PA | 1..142 | 11..154 | 330 | 50.7 | Plus |
Dsim\GD10509-PA | 147 | GD10509-PA | 1..147 | 11..154 | 240 | 40.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:06:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK21717-PA | 144 | GK21717-PA | 1..144 | 11..154 | 311 | 45.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:06:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19148-PA | 144 | GE19148-PA | 1..144 | 11..154 | 649 | 84.7 | Plus |