Clone IP04328 Report

Search the DGRC for IP04328

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:43
Well:28
Vector:pOT2
Associated Gene/TranscriptCG12825-RA
Protein status:IP04328.pep: gold
Preliminary Size:435
Sequenced Size:585

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12825 2005-01-01 Successful iPCR screen
CG12825 2008-04-29 Release 5.5 accounting
CG12825 2008-08-15 Release 5.9 accounting
CG12825 2008-12-18 5.12 accounting

Clone Sequence Records

IP04328.complete Sequence

585 bp (585 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022933.1

> IP04328.complete
CGGTCTGCAAGTTACTCTGCGATTTTGGAAACATGTGGAAGCTGGACACC
AAAGGAGGAATCATCTGCTCGGGCTGCCTGTCCATAGCCTTTGCCATAAC
CTATCTGGTTTTGATGGACGATTACTTCTGGAAATATGGACTCTACGAGA
TGGGAATACACATTTCGGCGCTGCAGATCTTGGGAAGCGTGGTCCTCATC
GTTGGAGCCATAAAGCAAAAGCACAAGTTCTTCGTGCCGTGGATGATAAC
CACAGGATTCTTTTTATACCTGATGGTGAACCTGTTCATTTCACTGATAG
TCCAGGGCACAGCTTGGATCTTCGGACCATTGATGGTCGTTCCGTTCACA
GCCTATCTGGGCTGCGCCCTGTACTCGGTGCAGAAGGCCTTCGACAGGAT
GCGCAAGGAGGAGCCACCGGCATATGCCAGCTTGTCCGACAAGAAGGAGT
TCATCAATCACATATAGATACATATATAAGCAATTTCAATACAAACAAAA
AAAAGATTAAAGGTAGATCAGATAGCTGGAAAATAAAAGCTCATTTTAAG
TGCTATTCAAACGAAACAAAAAAAAAAAAAAAAAA

IP04328.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825.b 2521 CG12825.b 1898..2467 1..570 2850 100 Plus
CG12825.c 1536 CG12825.c 913..1482 1..570 2850 100 Plus
CG12825.d 1034 CG12825.d 411..980 1..570 2850 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3677091..3677309 349..567 1095 100 Plus
chr2R 21145070 chr2R 3676891..3677033 209..351 685 98.6 Plus
chr2R 21145070 chr2R 3676545..3676679 1..135 675 100 Plus
chr2R 21145070 chr2R 3676742..3676821 136..215 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:41:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7789770..7789991 349..570 1110 100 Plus
2R 25286936 2R 7789570..7789712 209..351 700 99.3 Plus
2R 25286936 2R 7789224..7789358 1..135 675 100 Plus
2R 25286936 2R 7789421..7789500 136..215 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7790969..7791190 349..570 1110 100 Plus
2R 25260384 2R 7790769..7790911 209..351 700 99.3 Plus
2R 25260384 2R 7790423..7790557 1..135 675 100 Plus
2R 25260384 2R 7790620..7790699 136..215 400 100 Plus
2R 25260384 2R 7792102..7792135 376..409 140 94.1 Plus
Blast to na_te.dros performed on 2019-03-15 12:37:28 has no hits.

IP04328.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:38:30 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3676545..3676679 1..135 100 -> Plus
chr2R 3676742..3676821 136..215 100 -> Plus
chr2R 3676898..3677033 216..351 99 -> Plus
chr2R 3677094..3677309 352..567 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:45 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 33..467 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:22:36 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 33..467 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:47:40 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 33..467 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:30 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 33..467 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:06:22 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 1..435 33..467 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:05 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 11..577 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:22:36 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 11..577 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:47:40 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 19..585 1..567 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:31 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 11..577 1..567 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:06:22 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
CG12825-RA 19..585 1..567 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:30 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789773..7789988 352..567 100   Plus
2R 7789421..7789500 136..215 100 -> Plus
2R 7789577..7789712 216..351 100 -> Plus
2R 7789224..7789358 1..135 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:30 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789773..7789988 352..567 100   Plus
2R 7789421..7789500 136..215 100 -> Plus
2R 7789577..7789712 216..351 100 -> Plus
2R 7789224..7789358 1..135 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:38:30 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7789773..7789988 352..567 100   Plus
2R 7789421..7789500 136..215 100 -> Plus
2R 7789577..7789712 216..351 100 -> Plus
2R 7789224..7789358 1..135 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:47:40 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3676729..3676863 1..135 100 -> Plus
arm_2R 3676926..3677005 136..215 100 -> Plus
arm_2R 3677082..3677217 216..351 100 -> Plus
arm_2R 3677278..3677493 352..567 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:58 Download gff for IP04328.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7790972..7791187 352..567 100   Plus
2R 7790423..7790557 1..135 100 -> Plus
2R 7790620..7790699 136..215 100 -> Plus
2R 7790776..7790911 216..351 100 -> Plus

IP04328.hyp Sequence

Translation from 0 to 565

> IP04328.hyp
GLQVTLRFWKHVEAGHQRRNHLLGLPVHSLCHNLSGFDGRLLLEIWTLRD
GNTHFGAADLGKRGPHRWSHKAKAQVLRAVDDNHRILFIPDGEPVHFTDS
PGHSLDLRTIDGRSVHSLSGLRPVLGAEGLRQDAQGGATGICQLVRQEGV
HQSHIDTYISNFNTNKKKIKGRSDSWKIKAHFKCYSNE
Sequence IP04328.hyp has no blast hits.

IP04328.pep Sequence

Translation from 2 to 466

> IP04328.pep
VCKLLCDFGNMWKLDTKGGIICSGCLSIAFAITYLVLMDDYFWKYGLYEM
GIHISALQILGSVVLIVGAIKQKHKFFVPWMITTGFFLYLMVNLFISLIV
QGTAWIFGPLMVVPFTAYLGCALYSVQKAFDRMRKEEPPAYASLSDKKEF
INHI*

IP04328.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13201-PA 144 GF13201-PA 1..144 11..154 566 75 Plus
Dana\GF13202-PA 72 GF13202-PA 34..72 116..154 150 71.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:06:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23302-PA 138 GG23302-PA 1..138 11..154 542 74.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12825-PA 144 CG12825-PA 1..144 11..154 761 100 Plus
CG12824-PB 142 CG12824-PB 1..142 11..154 327 49 Plus
CG12824-PA 87 CG12824-PA 1..62 11..74 151 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10838-PA 142 GL10838-PA 1..142 11..154 456 61.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11836-PA 142 GA11836-PA 1..142 11..154 454 61.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20980-PA 144 GM20980-PA 1..144 11..154 680 90.3 Plus
Dsec\GM20981-PA 109 GM20981-PA 1..91 11..98 149 40.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10508-PA 144 GD10508-PA 1..144 11..154 679 88.9 Plus
Dsim\GD15357-PA 142 GD15357-PA 1..142 11..154 330 50.7 Plus
Dsim\GD10509-PA 147 GD10509-PA 1..147 11..154 240 40.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21717-PA 144 GK21717-PA 1..144 11..154 311 45.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:06:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19148-PA 144 GE19148-PA 1..144 11..154 649 84.7 Plus