Clone IP04370 Report

Search the DGRC for IP04370

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:43
Well:70
Vector:pOT2
Associated Gene/TranscriptCG13931-RA
Protein status:IP04370.pep: gold
Preliminary Size:489
Sequenced Size:683

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13931 2005-01-01 Successful iPCR screen
CG13931 2008-04-29 Release 5.5 accounting
CG13931 2008-08-15 Release 5.9 accounting
CG13931 2008-12-18 5.12 accounting

Clone Sequence Records

IP04370.complete Sequence

683 bp (683 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022924

> IP04370.complete
AACGCGCGCCACTCGGCGGTGGCAGTGGACGAACTGAAGGATTAATTAAG
GACCTGCTTAACCAGCTTAATCAGCAGCCACATCAGCCAAATCTACATCT
GCTAAATGTCCAAACTGTCATCTGGTGGTCCCTCCATGGCGGCCAAGCTG
CTGGCCATAATGCTTCTGCTGGTGGCGACGGGAGTGCAGGCGCGGCGTCT
GGGCCACCGACGCCTAATCATCCACGTGCCGGTCAAGGTGAAGACGCACC
ACCACACTCACACCGTGTACAAGGTGCTACACGGATCACATGGTGGCGGT
GGCGGCGGAGGTGTAAAGCAAACGGTATACAAAGTGCTTGGCTTCTCCAC
ACACGGTGGTGGCATTGCCAAGGGCGGCGTAGGAGGAGGAGGAGGCATTG
GCCATGGAGCCCACGGTAGCTACGACATGGGCAGCATAGGAGGAATGGGA
CACGGCGAAATCACATACGAGGACATGCACGGATGCGAGAGCGGCAAAGT
GATTCCGGCGGCCAGAGACATGATTTTCAATCACTACTCGCGTCACGGCC
AAAGCGATGGAACTGCCGAGGATTACGCCGAGGAGCTGGACGACTTTGTA
GACCTAAGGGATGGCTGGTTGTGAATAAAGAGACGTGTGCGCAAATCCCC
GCCGATTAATTATAAAAAAAAAAAAAAAAAAAA

IP04370.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13931.a 1082 CG13931.a 20..686 1..667 3335 100 Plus
CG13931-RA 925 CG13931-RA 20..686 1..667 3335 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1700916..1701464 663..115 2745 100 Minus
chr3L 24539361 chr3L 1701854..1701967 114..1 570 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1701352..1701904 667..115 2765 100 Minus
3L 28110227 3L 1702294..1702407 114..1 570 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1701352..1701904 667..115 2765 100 Minus
3L 28103327 3L 1702294..1702407 114..1 570 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:45:44 has no hits.

IP04370.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:43 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1700916..1701464 115..663 100 <- Minus
chr3L 1701854..1701967 1..114 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:50 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..519 106..624 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:22:21 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..519 106..624 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:13 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..519 106..624 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:15 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..519 106..624 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:57 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..519 106..624 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:23:35 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..636 7..642 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:22:20 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..663 1..663 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:13 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..663 1..663 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:15 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..636 7..642 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:57 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
CG13931-RA 1..663 1..663 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:43 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1701356..1701904 115..663 100 <- Minus
3L 1702294..1702407 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:43 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1701356..1701904 115..663 100 <- Minus
3L 1702294..1702407 1..114 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:43 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1701356..1701904 115..663 100 <- Minus
3L 1702294..1702407 1..114 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:13 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1701356..1701904 115..663 100 <- Minus
arm_3L 1702294..1702407 1..114 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:42 Download gff for IP04370.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1701356..1701904 115..663 100 <- Minus
3L 1702294..1702407 1..114 100   Minus

IP04370.pep Sequence

Translation from 105 to 623

> IP04370.pep
MSKLSSGGPSMAAKLLAIMLLLVATGVQARRLGHRRLIIHVPVKVKTHHH
THTVYKVLHGSHGGGGGGGVKQTVYKVLGFSTHGGGIAKGGVGGGGGIGH
GAHGSYDMGSIGGMGHGEITYEDMHGCESGKVIPAARDMIFNHYSRHGQS
DGTAEDYAEELDDFVDLRDGWL*

IP04370.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:57:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24972-PA 163 GF24972-PA 1..163 1..172 473 73.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14571-PA 170 GG14571-PA 1..170 1..172 624 86.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:58:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15512-PA 171 GH15512-PA 26..171 28..172 365 59.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13931-PB 172 CG13931-PB 1..172 1..172 925 100 Plus
CG13931-PA 172 CG13931-PA 1..172 1..172 925 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16788-PA 180 GI16788-PA 26..180 28..172 350 58.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12388-PA 182 GL12388-PA 31..182 30..172 416 69.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:58:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12636-PA 180 GA12636-PA 31..180 30..172 418 70 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14182-PA 170 GM14182-PA 1..170 1..172 552 93 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13449-PA 110 GD13449-PA 1..110 1..112 266 88.4 Plus
Dsim\GD13450-PA 49 GD13450-PA 1..49 124..172 238 91.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:58:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12531-PA 174 GJ12531-PA 26..174 28..172 395 64 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17065-PA 158 GK17065-PA 3..158 28..172 312 58.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20928-PA 172 GE20928-PA 1..172 1..172 649 93.6 Plus

IP04370.hyp Sequence

Translation from 105 to 623

> IP04370.hyp
MSKLSSGGPSMAAKLLAIMLLLVATGVQARRLGHRRLIIHVPVKVKTHHH
THTVYKVLHGSHGGGGGGGVKQTVYKVLGFSTHGGGIAKGGVGGGGGIGH
GAHGSYDMGSIGGMGHGEITYEDMHGCESGKVIPAARDMIFNHYSRHGQS
DGTAEDYAEELDDFVDLRDGWL*

IP04370.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG13931-PB 172 CG13931-PB 1..172 1..172 925 100 Plus
CG13931-PA 172 CG13931-PA 1..172 1..172 925 100 Plus