Clone IP04416 Report

Search the DGRC for IP04416

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:44
Well:16
Vector:pOT2
Associated Gene/TranscriptCpr64Ab-RA
Protein status:IP04416.pep: gold
Preliminary Size:444
Sequenced Size:576

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15007 2005-01-01 Successful iPCR screen
Cpr64Ab 2008-04-29 Release 5.5 accounting
Cpr64Ab 2008-08-15 Release 5.9 accounting
Cpr64Ab 2008-12-18 5.12 accounting

Clone Sequence Records

IP04416.complete Sequence

576 bp (576 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022916

> IP04416.complete
CAAGCACAAAGCACCATTGGAAAACCACTATCCACCAGCAAATCTAGTCA
TGGCCCTGATCAAGATCACCCTCATCTGCTGCGCTCTGATCGCCGCCATC
GAGTGCGCCCTGCTCCCAGCTGCTGTTCCAGTGGGAGTGCCCCTCAACAC
GGAGGTGGATCCACATCCGCAGTACGCGTTCGCCTATAATGTGCAGGATG
CCCTTACCGGGGACAGCAAGAGCCAGCAGGAGGTGCGGGATGGAGATGTG
GTCAAGGGCTCCTACTCGGTGGTCGATGCCGATGGTTCACTGCGCACCGT
CTTCTACACCGCCGATCCCATCAACGGTTTCAATGCGGTGGTGCAGCGAG
GACCAGTTCCGGTGGCTGCTCGCCCATTGGTGGCTCCAGTGGCTGCTCCA
ATCTTGGGCTAACTCCACAATCTTTCAGAGCCTTTAACACTGCTTGTAAC
CTAGCTTTTACATAACTTATTGTCTGCTCCTTAGTCCGTTGTAAAGTCAG
TAATCATTAAACAATAAACTCAATAAGCCAAAGAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAA

IP04416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ab-RA 676 Cpr64Ab-RA 82..617 1..536 2680 100 Plus
Cpr64Ad-RB 1088 Cpr64Ad-RB 561..752 155..346 270 76 Plus
Cpr30F-RA 787 Cpr30F-RA 372..510 206..344 230 77.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4210266..4210736 533..63 2355 100 Minus
chr3L 24539361 chr3L 4210844..4210907 64..1 320 100 Minus
chr3L 24539361 chr3L 4215328..4215519 155..346 270 76 Plus
chr3R 27901430 chr3R 2518821..2518996 158..333 235 75.6 Plus
chr2L 23010047 chr2L 9931638..9931776 344..206 230 77.7 Minus
chr3L 24539361 chr3L 1840562..1840654 316..224 225 82.8 Minus
chr3R 27901430 chr3R 2515579..2515754 333..158 205 74.4 Minus
chr2L 23010047 chr2L 10054265..10054367 256..358 185 78.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4210877..4211350 536..63 2370 100 Minus
3L 28110227 3L 4211458..4211521 64..1 320 100 Minus
3L 28110227 3L 4215942..4216133 155..346 270 76 Plus
3R 32079331 3R 6693027..6693202 158..333 235 75.6 Plus
2L 23513712 2L 9932724..9932862 344..206 230 77.7 Minus
3L 28110227 3L 1841032..1841124 316..224 210 81.7 Minus
3R 32079331 3R 6689785..6689960 333..158 205 74.4 Minus
2L 23513712 2L 10055335..10055437 256..358 185 78.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4210877..4211350 536..63 2370 100 Minus
3L 28103327 3L 4211458..4211521 64..1 320 100 Minus
3L 28103327 3L 4215942..4216133 155..346 270 76 Plus
2L 23513712 2L 9932724..9932862 344..206 230 77.6 Minus
3L 28103327 3L 1841032..1841124 316..224 210 81.7 Minus
2L 23513712 2L 10055335..10055437 256..358 185 78.6 Plus
Blast to na_te.dros performed on 2019-03-16 14:17:02 has no hits.

IP04416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:18:13 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4210266..4210734 65..533 100 <- Minus
chr3L 4210844..4210907 1..64 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:54 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 1..363 50..412 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:22:42 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 1..363 50..412 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:37 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 1..363 50..412 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:06:37 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 1..363 50..412 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:48 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 1..363 50..412 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:24:13 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 21..553 1..533 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:22:42 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 20..552 1..533 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:37 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 20..552 1..533 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:06:38 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 21..553 1..533 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:48 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
Cpr64Ab-RA 20..552 1..533 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:13 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4210880..4211348 65..533 100 <- Minus
3L 4211458..4211521 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:13 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4210880..4211348 65..533 100 <- Minus
3L 4211458..4211521 1..64 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:13 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4210880..4211348 65..533 100 <- Minus
3L 4211458..4211521 1..64 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:37 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4210880..4211348 65..533 100 <- Minus
arm_3L 4211458..4211521 1..64 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:43:04 Download gff for IP04416.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4210880..4211348 65..533 100 <- Minus
3L 4211458..4211521 1..64 100   Minus

IP04416.hyp Sequence

Translation from 0 to 411

> IP04416.hyp
KHKAPLENHYPPANLVMALIKITLICCALIAAIECALLPAAVPVGVPLNT
EVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTV
FYTADPINGFNAVVQRGPVPVAARPLVAPVAAPILG*

IP04416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ab-PA 120 CG15007-PA 1..120 17..136 611 100 Plus
Ccp84Ad-PA 199 CG2341-PA 45..140 41..134 302 64.6 Plus
Cpr64Ad-PB 247 CG1259-PB 126..218 39..132 299 67.4 Plus
Ccp84Ag-PA 191 CG2342-PA 4..118 21..133 297 55.2 Plus
Cpr5C-PA 145 CG4052-PA 43..137 37..131 294 63.2 Plus

IP04416.pep Sequence

Translation from 1 to 411

> IP04416.pep
KHKAPLENHYPPANLVMALIKITLICCALIAAIECALLPAAVPVGVPLNT
EVDPHPQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTV
FYTADPINGFNAVVQRGPVPVAARPLVAPVAAPILG*

IP04416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23876-PA 119 GF23876-PA 1..119 17..136 542 90.1 Plus
Dana\GF21210-PA 141 GF21210-PA 47..138 41..128 288 66.3 Plus
Dana\GF17801-PA 217 GF17801-PA 44..129 51..135 286 63.2 Plus
Dana\GF17186-PA 221 GF17186-PA 54..133 40..119 285 66.2 Plus
Dana\GF17800-PA 223 GF17800-PA 1..137 17..134 272 48.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14206-PA 148 GG14206-PA 12..148 1..136 676 97.1 Plus
Dere\GG18788-PA 145 GG18788-PA 49..137 43..131 291 65.2 Plus
Dere\GG13631-PA 199 GG13631-PA 47..123 43..119 283 68.8 Plus
Dere\GG10291-PA 215 GG10291-PA 1..139 17..134 278 48.6 Plus
Dere\GG10302-PA 211 GG10302-PA 44..112 51..119 274 69.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15545-PA 117 GH15545-PA 1..117 17..136 447 77.6 Plus
Dgri\GH19487-PA 201 GH19487-PA 68..136 51..119 285 75.4 Plus
Dgri\GH19489-PA 147 GH19489-PA 46..139 41..134 281 61.7 Plus
Dgri\GH18128-PA 166 GH18128-PA 60..130 51..121 279 71.8 Plus
Dgri\GH19488-PA 195 GH19488-PA 42..116 51..125 273 66.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:04:37
Subject Length Description Subject Range Query Range Score Percent Strand
Cpr64Ab-PA 120 CG15007-PA 1..120 17..136 611 100 Plus
Ccp84Ad-PA 199 CG2341-PA 45..140 41..134 302 64.6 Plus
Cpr64Ad-PB 247 CG1259-PB 126..218 39..132 299 67.4 Plus
Ccp84Ag-PA 191 CG2342-PA 4..118 21..133 297 55.2 Plus
Cpr5C-PA 145 CG4052-PA 43..137 37..131 294 63.2 Plus
Ccp84Ab-PA 221 CG1252-PA 34..140 30..134 291 57.9 Plus
Ccp84Ae-PA 208 CG1330-PA 6..129 24..135 287 53.6 Plus
Ccp84Aa-PA 205 CG2360-PA 34..140 30..134 285 57 Plus
Ccp84Af-PA 151 CG1331-PA 45..143 41..134 269 58.6 Plus
Cpr92A-PA 245 CG6240-PA 63..148 53..134 264 60.5 Plus
Ccp84Ac-PA 217 CG1327-PA 60..139 53..134 261 65.9 Plus
Cpr64Aa-PA 192 CG15006-PA 4..135 21..133 260 45.5 Plus
Cpr31A-PA 340 CG33302-PA 90..208 12..132 260 51.2 Plus
Cpr62Bc-PB 180 CG1919-PB 1..130 17..133 239 48.9 Plus
Cpr62Bc-PA 180 CG1919-PA 1..130 17..133 239 48.9 Plus
Edg84A-PA 188 CG2345-PA 32..113 53..135 238 61.4 Plus
Cpr62Bb-PC 194 CG13935-PC 32..115 55..135 235 59.5 Plus
Cpr62Bb-PB 194 CG13935-PB 32..115 55..135 235 59.5 Plus
Cpr62Bb-PA 194 CG13935-PA 32..115 55..135 235 59.5 Plus
Cpr30F-PA 146 CG31876-PA 1..127 16..134 230 44.9 Plus
Crys-PB 477 CG16963-PB 68..135 49..116 223 57.4 Plus
Crys-PA 477 CG16963-PA 68..135 49..116 223 57.4 Plus
CG34461-PB 138 CG34461-PB 42..129 48..135 218 54.9 Plus
CG34461-PA 138 CG34461-PA 42..129 48..135 218 54.9 Plus
Cpr64Ac-PA 188 CG15008-PA 63..171 32..135 215 47.7 Plus
Cpr23B-PA 302 CG2973-PA 150..228 51..131 213 56.8 Plus
Cpr66Cb-PA 162 CG7076-PA 87..147 56..116 210 67.2 Plus
Cpr76Bb-PA 198 CG9290-PA 79..144 53..116 203 62.1 Plus
Cpr76Bc-PD 424 CG9295-PD 53..113 55..115 197 63.9 Plus
Cpr76Bc-PC 424 CG9295-PC 53..113 55..115 197 63.9 Plus
Cpr76Bd-PD 1228 CG9299-PD 1148..1209 53..114 190 61.3 Plus
Cpr76Bd-PB 1228 CG9299-PB 1148..1209 53..114 190 61.3 Plus
Cpr76Bd-PC 1231 CG9299-PC 1151..1212 53..114 190 61.3 Plus
Cpr76Ba-PA 204 CG9283-PA 97..157 55..115 179 57.4 Plus
Cpr66D-PA 270 CG32029-PA 153..235 53..135 179 43.4 Plus
CG42367-PC 103 CG42367-PC 2..100 14..119 178 43.4 Plus
Cpr30B-PA 153 CG3818-PA 4..117 21..135 174 38.2 Plus
Cpr35B-PA 218 CG3474-PA 67..130 53..116 171 54.7 Plus
CG13670-PA 266 CG13670-PA 101..159 56..114 168 55.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16820-PA 118 GI16820-PA 1..96 17..117 427 81.2 Plus
Dmoj\GI14579-PA 118 GI14579-PA 1..96 17..117 427 81.2 Plus
Dmoj\GI23757-PA 176 GI23757-PA 45..146 37..133 294 60.8 Plus
Dmoj\GI23842-PA 176 GI23842-PA 59..146 51..133 294 67 Plus
Dmoj\GI23759-PA 145 GI23759-PA 48..136 43..133 283 64.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21770-PA 213 GL21770-PA 1..123 17..119 287 52 Plus
Dper\GL22051-PA 217 GL22051-PA 45..122 51..127 274 64.1 Plus
Dper\GL22049-PA 231 GL22049-PA 66..145 53..132 270 66.2 Plus
Dper\GL21772-PA 223 GL21772-PA 34..102 51..119 269 71 Plus
Dper\GL22052-PA 151 GL22052-PA 47..123 43..119 267 67.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28204-PA 142 GA28204-PA 17..128 5..120 506 82.8 Plus
Dpse\GA26395-PA 213 GA26395-PA 45..123 41..119 282 67.1 Plus
Dpse\GA12183-PB 217 GA12183-PB 45..122 51..127 274 64.1 Plus
Dpse\GA12160-PA 231 GA12160-PA 66..145 53..132 271 66.2 Plus
Dpse\GA27360-PA 151 GA27360-PA 47..123 43..119 267 67.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13998-PA 147 GM13998-PA 12..147 1..136 690 97.8 Plus
Dsec\GM12439-PA 145 GM12439-PA 43..137 37..131 297 64.2 Plus
Dsec\GM10911-PA 199 GM10911-PA 47..123 43..119 283 68.8 Plus
Dsec\GM10534-PA 208 GM10534-PA 44..129 51..135 273 63.2 Plus
Dsec\GM10535-PA 151 GM10535-PA 47..123 43..119 269 64.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:56:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13279-PA 147 GD13279-PA 12..147 1..136 692 97.8 Plus
Dsim\GD16755-PA 145 GD16755-PA 43..137 37..131 296 64.2 Plus
Dsim\GD19526-PA 236 GD19526-PA 55..140 51..134 283 65.1 Plus
Dsim\GD19528-PA 217 GD19528-PA 1..139 17..134 272 48.6 Plus
Dsim\GD19531-PA 151 GD19531-PA 47..123 43..119 269 64.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12566-PA 272 GJ12566-PA 154..248 17..116 417 82 Plus
Dvir\GJ23301-PA 175 GJ23301-PA 45..145 37..134 291 62.4 Plus
Dvir\GJ23942-PA 183 GJ23942-PA 42..124 51..131 288 66.3 Plus
Dvir\GJ23940-PA 200 GJ23940-PA 45..127 37..119 285 66.3 Plus
Dvir\GJ23943-PA 155 GJ23943-PA 48..124 43..119 277 68.8 Plus
Dvir\GJ12566-PA 272 GJ12566-PA 75..157 53..133 216 55.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:56:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10237-PA 116 GK10237-PA 1..95 17..117 362 75.5 Plus
Dwil\GK10834-PA 219 GK10834-PA 54..132 41..119 283 68.4 Plus
Dwil\GK12248-PA 219 GK12248-PA 54..132 41..119 283 68.4 Plus
Dwil\GK12728-PA 241 GK12728-PA 133..231 52..135 281 58.4 Plus
Dwil\GK10832-PA 179 GK10832-PA 50..127 53..131 266 67.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20635-PA 120 GE20635-PA 1..120 17..136 607 99.2 Plus
Dyak\GE16433-PA 154 GE16433-PA 42..131 30..119 296 65.6 Plus
Dyak\GE25837-PA 202 GE25837-PA 44..129 51..135 287 65.5 Plus
Dyak\GE24880-PA 181 GE24880-PA 47..123 43..119 282 68.8 Plus
Dyak\GE25835-PA 212 GE25835-PA 7..115 15..119 277 54.1 Plus