Clone IP04417 Report

Search the DGRC for IP04417

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:44
Well:17
Vector:pOT2
Associated Gene/TranscriptCG15019-RA
Protein status:IP04417.pep: gold
Preliminary Size:441
Sequenced Size:680

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15019 2005-01-01 Successful iPCR screen
CG15019 2008-04-29 Release 5.5 accounting
CG15019 2008-08-15 Release 5.9 accounting
CG15019 2008-12-18 5.12 accounting

Clone Sequence Records

IP04417.complete Sequence

680 bp (680 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023677

> IP04417.complete
ACGTTTTTAGCAAATTGAACGCAATTTCTTTACTTCTTTGACTTTTTCTG
GTATTACTTAATATCCGACTACCGAAATGGGCAGAAACAATCGCTCGAGA
AAGCGTCGTGATGAAATGAATAAGATAAAGAAGGCGCGGTACGAAGCCAA
GGAGTTAATTCGACTGAAGAAAACTCTGGGACTCCTAGATGCCGATGGAA
ATGAGATCATGAAGGATATAAGCGATGTGGTCGAAATTAAGACCGCCAAG
GAGCTCAAAAGGGAGGCCAAATCCAAGGAGGAGCAGGAATTGATCTACGA
GCACCAGGAGAGTCTGGAGAAGGGCGAGAAAGTCAAGGTGACCAACGAGA
ACACGGGCGTGGAGCACATTTTCAACAGCAAGACCCTCAAAGATCAGTAC
GGCAATTATCCTGCGTGGTTCAAGAAGAAGAAGACCGCCAAGCGTCTAAG
AAAGAAGCAGCACTCGCAGAAGAAGAACTTCAAACAGGCCTGGACCACGG
TTAATGTTCCCCTATAAATCCGGGGCTGGGTTACCCATCTGGTATCTTAT
CGTAGTTTATAAGTCCTCGCTTAGTTTAGGAGATTTTGTAGGCTTTTTCT
ACAAAGATGTTATAGCTAAGAGTATATATTGCATATTAAAGCCCAAACAA
GTTCTGAAAAACCCAAAAAAAAAAAAAAAA

IP04417.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15019-RA 769 CG15019-RA 46..710 1..665 3325 100 Plus
CG15019-RB 870 CG15019-RB 46..710 1..665 3325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4404651..4405050 661..262 1925 98.8 Minus
chr3L 24539361 chr3L 4405218..4405479 263..1 1265 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4405213..4405616 665..262 2020 100 Minus
3L 28110227 3L 4405784..4406046 263..1 1315 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4405213..4405616 665..262 2020 100 Minus
3L 28103327 3L 4405784..4406046 263..1 1315 100 Minus
Blast to na_te.dros performed on 2019-03-16 14:17:15 has no hits.

IP04417.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:18:19 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4404648..4405049 263..664 98 <- Minus
chr3L 4405219..4405479 1..262 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:23:55 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RB 1..441 77..517 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:35 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RB 1..441 77..517 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:25:44 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RA 1..441 77..517 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:36 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RB 1..441 77..517 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:29:55 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RA 1..441 77..517 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:55:41 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RB 14..677 1..664 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:35 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RB 14..677 1..664 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:25:44 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RA 14..677 1..664 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:36 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RB 14..677 1..664 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:29:55 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
CG15019-RA 14..677 1..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:19 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4405214..4405615 263..664 100 <- Minus
3L 4405785..4406046 1..262 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:19 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4405214..4405615 263..664 100 <- Minus
3L 4405785..4406046 1..262 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:18:19 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4405214..4405615 263..664 100 <- Minus
3L 4405785..4406046 1..262 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:25:44 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4405214..4405615 263..664 100 <- Minus
arm_3L 4405785..4406046 1..262 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:00:40 Download gff for IP04417.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4405785..4406046 1..262 100   Minus
3L 4405214..4405615 263..664 100 <- Minus

IP04417.hyp Sequence

Translation from 76 to 516

> IP04417.hyp
MGRNNRSRKRRDEMNKIKKARYEAKELIRLKKTLGLLDADGNEIMKDISD
VVEIKTAKELKREAKSKEEQELIYEHQESLEKGEKVKVTNENTGVEHIFN
SKTLKDQYGNYPAWFKKKKTAKRLRKKQHSQKKNFKQAWTTVNVPL*

IP04417.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG15019-PB 146 CG15019-PB 1..146 1..146 749 100 Plus
CG15019-PA 146 CG15019-PA 1..146 1..146 749 100 Plus

IP04417.pep Sequence

Translation from 76 to 516

> IP04417.pep
MGRNNRSRKRRDEMNKIKKARYEAKELIRLKKTLGLLDADGNEIMKDISD
VVEIKTAKELKREAKSKEEQELIYEHQESLEKGEKVKVTNENTGVEHIFN
SKTLKDQYGNYPAWFKKKKTAKRLRKKQHSQKKNFKQAWTTVNVPL*

IP04417.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24733-PA 146 GF24733-PA 1..146 1..146 698 89.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14188-PA 146 GG14188-PA 1..146 1..146 737 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15813-PA 146 GH15813-PA 1..146 1..146 619 80.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15019-PB 146 CG15019-PB 1..146 1..146 749 100 Plus
CG15019-PA 146 CG15019-PA 1..146 1..146 749 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12595-PA 146 GI12595-PA 1..146 1..146 635 82.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17952-PA 146 GL17952-PA 1..146 1..146 708 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28349-PA 146 GA28349-PA 1..146 1..146 708 91.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13977-PA 110 GM13977-PA 1..108 1..109 503 93.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13260-PA 146 GD13260-PA 1..146 1..146 749 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12716-PA 146 GJ12716-PA 1..146 1..146 633 82.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11726-PA 146 GK11726-PA 1..146 1..146 708 91.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20617-PA 146 GE20617-PA 1..146 1..146 734 97.3 Plus