Clone IP04447 Report

Search the DGRC for IP04447

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:44
Well:47
Vector:pOT2
Associated Gene/TranscriptCG15800-RA
Protein status:IP04447.pep: gold
Preliminary Size:475
Sequenced Size:1147

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15800 2005-01-01 Successful iPCR screen
CG15800 2008-04-29 Release 5.5 accounting
RpS11 2008-08-15 Release 5.9 accounting
CG15800 2008-08-15 Release 5.9 accounting
RpS11 2008-12-18 5.12 accounting
CG15800 2008-12-18 5.12 accounting

Clone Sequence Records

IP04447.complete Sequence

1147 bp (1147 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023675

> IP04447.complete
AAGAATGGTGCGATTCGAGACAAGGGACGGCCGTACGATAAGCGTAAATC
TGGCTCTGCTCGAGAAATCCTTGGTGATCCGGGAGATGTGCCGCGTTGGC
CAGGTCCCAGAGGATGAGGACTTCGTCCTGCCGCTGCACGGTATACACAG
CAATGTCCTGCTGAAGATCTTGCTGTGGGCTGAGTACCATGAGAAACACG
AAGAGCCCGCCTGGGTGGACAGCAAAGATCCTCTTCCGGCCGAGGAGATT
GAGCTGCAGATCTCCGATTGGGACAAGGAGTTCCTGCGCGTGGAAATCGA
TAGCATTTGCAAAATCATGGAGGGCTGCAACTACTTGGACATCCCTTGGC
TCTACAAGCTCTGTGCCCAGAAACTCGTCTTCCTCAGCAGCCGAGAGCCG
GAGACGCAGTTCAGCGGTTACGTGGAGAAGATCCCAAGATTCCAGGATCA
TTTCATTGAGCAAATTCAAAAGGAATAGGGTGATTTGTAAAAGGAACGTT
TGGGCTAAAATTGTCTCTTGGCTGTATTCAAAACTGCTGAAATTCAAAGA
ATAAAAAATATTAATAATAATAGTAGTAAAAAAAAAAAAAAAAACCAGAA
CGAGCGCGCCTTCCAAAAACAATTCGGTGTCAACCTAAACCGCAAGGTCA
AGCCCGGTATCACCAAGAAGAAGCTGCTGCGTCGCTCCCGCGATGTGGGA
CTCGGTTTCAAGACCCCACGTGAGGCCATCGATGGTACCTACATCGACAA
GAAGTGCCCCTGGACCGGTGATGTGAGGATCCGTGGTCGCATTCTGACCG
GCGTGGTCCGCAAGGCCAAGATGCAGCGCACCATTGTCATTCGGCGCGAC
TACCTGCACTTTGTGCGCAAATACAGCCGTTTCGAGAAGCGTCACCGCAA
CATGAGCGTCCACTGCTCCCCTGTGTTCAGAGATGTTGAGCATGGCGATA
TTGTCACCATTGGTGAGTGCCGTCCTCTGTCCAAGACTGTGCGCTTCAAC
GTCCTGAAAGTCAGCAAGGGTCAGGGAGCCAAGAAGAGCTTCAAGAAGTA
CTAGAGCGGACAACTACCATTCGGGCGATAATATTTGTAGCAATTATTCT
TTTTGAATAAAACAAAAAAAAGTAACTTTAAAAAAAAAAAAAAAAAA

IP04447.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:24
Subject Length Description Subject Range Query Range Score Percent Strand
RpS11-RC 894 RpS11-RC 189..724 596..1131 2680 100 Plus
RpS11.a 897 RpS11.a 194..728 597..1131 2675 100 Plus
RpS11.b 772 RpS11.b 70..603 596..1131 2625 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19676678..19677256 579..1 2775 98.6 Minus
chr2R 21145070 chr2R 8087050..8087257 930..723 1040 100 Minus
chr2R 21145070 chr2R 8086607..8086808 1129..928 1010 100 Minus
chr2R 21145070 chr2R 8087331..8087463 725..593 665 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23790618..23791196 579..1 2880 99.8 Minus
2R 25286936 2R 12199834..12200041 930..723 1040 100 Minus
2R 25286936 2R 12199389..12199592 1131..928 1020 100 Minus
2R 25286936 2R 12200115..12200247 725..593 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23791817..23792395 579..1 2880 99.8 Minus
2R 25260384 2R 12201033..12201240 930..723 1040 100 Minus
2R 25260384 2R 12200588..12200791 1131..928 1020 100 Minus
2R 25260384 2R 12201314..12201446 725..593 665 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:19:11 has no hits.

IP04447.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:19:51 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19676708..19677256 1..549 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:00 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
CG15800-RA 1..474 5..478 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:48 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
CG15800-RA 1..474 5..478 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:24 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
CG15800-RA 1..474 5..478 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:17 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
CG15800-RA 1..474 5..478 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:25:39 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
CG15800-RA 1..474 5..478 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:17 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RA 52..585 596..1129 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:48 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RC 52..585 596..1129 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:24 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
CG15800-RA 32..614 1..583 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:17 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
RpS11-RA 52..585 596..1129 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:25:39 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
CG15800-RA 32..614 1..583 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:51 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23790618..23791196 1..579 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:51 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23790618..23791196 1..579 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:19:51 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23790618..23791196 1..579 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:24 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19678141..19678719 1..579 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:49 Download gff for IP04447.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23791835..23792413 1..579 99   Minus

IP04447.hyp Sequence

Translation from 0 to 477

> IP04447.hyp
RMVRFETRDGRTISVNLALLEKSLVIREMCRVGQVPEDEDFVLPLHGIHS
NVLLKILLWAEYHEKHEEPAWVDSKDPLPAEEIELQISDWDKEFLRVEID
SICKIMEGCNYLDIPWLYKLCAQKLVFLSSREPETQFSGYVEKIPRFQDH
FIEQIQKE*

IP04447.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15800-PA 157 CG15800-PA 1..157 2..158 833 100 Plus
SkpD-PA 158 CG12700-PA 6..135 3..134 161 30.8 Plus
SkpF-PA 171 CG12227-PA 3..112 2..115 157 27.7 Plus
SkpC-PA 158 CG11941-PA 6..135 3..134 155 28.6 Plus
SkpA-PI 162 CG16983-PI 4..132 3..134 155 26.3 Plus

IP04447.pep Sequence

Translation from 1 to 477

> IP04447.pep
RMVRFETRDGRTISVNLALLEKSLVIREMCRVGQVPEDEDFVLPLHGIHS
NVLLKILLWAEYHEKHEEPAWVDSKDPLPAEEIELQISDWDKEFLRVEID
SICKIMEGCNYLDIPWLYKLCAQKLVFLSSREPETQFSGYVEKIPRFQDH
FIEQIQKE*

IP04447.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21823-PA 200 GF21823-PA 1..153 2..145 442 59.4 Plus
Dana\GF21176-PA 248 GF21176-PA 3..133 1..134 154 25.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20001-PA 160 GG20001-PA 1..159 2..157 669 80.5 Plus
Dere\GG12805-PA 162 GG12805-PA 4..132 3..134 152 26.3 Plus
Dere\GG20030-PA 170 GG20030-PA 3..111 2..114 136 26.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24737-PA 103 GH24737-PA 8..96 37..125 183 34.8 Plus
Dgri\GH19712-PA 162 GH19712-PA 4..132 3..134 160 27.1 Plus
Dgri\GH24518-PA 162 GH24518-PA 4..132 3..134 156 26.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG15800-PA 157 CG15800-PA 1..157 2..158 833 100 Plus
SkpD-PA 158 CG12700-PA 6..135 3..134 161 30.8 Plus
SkpF-PA 171 CG12227-PA 3..112 2..115 157 27.7 Plus
SkpC-PA 158 CG11941-PA 6..135 3..134 155 28.6 Plus
SkpA-PI 162 CG16983-PI 4..132 3..134 155 26.3 Plus
SkpA-PH 162 CG16983-PH 4..132 3..134 155 26.3 Plus
SkpA-PA 162 CG16983-PA 4..132 3..134 155 26.3 Plus
SkpA-PD 162 CG16983-PD 4..132 3..134 155 26.3 Plus
SkpA-PG 162 CG16983-PG 4..132 3..134 155 26.3 Plus
SkpA-PB 162 CG16983-PB 4..132 3..134 155 26.3 Plus
SkpA-PC 162 CG16983-PC 4..132 3..134 155 26.3 Plus
SkpA-PF 162 CG16983-PF 4..132 3..134 155 26.3 Plus
SkpA-PE 162 CG16983-PE 4..132 3..134 155 26.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14776-PA 142 GI14776-PA 4..122 3..125 276 49.6 Plus
Dmoj\GI15084-PA 162 GI15084-PA 4..132 3..134 164 27.8 Plus
Dmoj\GI11198-PA 148 GI11198-PA 4..124 3..128 137 29.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19294-PA 184 GL19294-PA 1..143 2..144 401 51 Plus
Dper\GL12870-PA 175 GL12870-PA 1..146 2..147 369 48.6 Plus
Dper\GL18093-PA 148 GL18093-PA 2..132 1..134 155 28.9 Plus
Dper\GL13359-PA 162 GL13359-PA 4..132 3..134 152 26.3 Plus
Dper\GL13358-PA 162 GL13358-PA 4..132 3..134 152 26.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25902-PA 175 GA25902-PA 1..143 2..144 403 51 Plus
Dpse\GA22610-PA 175 GA22610-PA 1..146 2..147 374 49.3 Plus
Dpse\GA14255-PA 162 GA14255-PA 4..132 3..134 150 26.3 Plus
Dpse\GA26757-PA 164 GA26757-PA 4..134 3..134 149 27.8 Plus
Dpse\GA26756-PA 164 GA26756-PA 4..134 3..134 146 27.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19084-PA 162 GM19084-PA 4..132 3..134 152 26.3 Plus
Dsec\GM22995-PA 168 GM22995-PA 15..145 2..134 142 25.4 Plus
Dsec\GM15542-PA 170 GM15542-PA 3..132 2..134 140 24.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25016-PA 160 GD25016-PA 1..160 2..158 714 87.5 Plus
Dsim\GD16521-PA 162 GD16521-PA 4..132 3..134 152 26.3 Plus
Dsim\GD25046-PA 170 GD25046-PA 3..132 2..134 141 24.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18822-PA 145 GJ18822-PA 4..141 3..141 333 50 Plus
Dvir\GJ18891-PA 200 GJ18891-PA 42..170 3..134 161 27.1 Plus
Dvir\GJ18483-PA 150 GJ18483-PA 4..124 3..126 148 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16429-PA 141 GK16429-PA 3..130 2..134 161 28.4 Plus
Dwil\GK23055-PA 154 GK23055-PA 4..129 3..134 153 30.8 Plus
Dwil\GK16428-PA 162 GK16428-PA 4..132 3..134 152 26.3 Plus
Dwil\GK21211-PA 162 GK21211-PA 4..132 3..134 151 28.6 Plus
Dwil\GK10153-PA 166 GK10153-PA 3..132 2..134 147 27.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11534-PA 194 GE11534-PA 34..193 1..157 698 84.4 Plus
Dyak\skpA-PA 162 GE16631-PA 4..132 3..134 154 27.1 Plus
Dyak\GE11566-PA 172 GE11566-PA 3..110 2..114 136 27.2 Plus