Clone IP04449 Report

Search the DGRC for IP04449

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:44
Well:49
Vector:pOT2
Associated Gene/TranscriptCG15882-RA
Protein status:IP04449.pep: gold
Preliminary Size:477
Sequenced Size:653

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15882 2005-01-01 Successful iPCR screen
CG15882 2008-04-29 Release 5.5 accounting
CG15882 2008-08-15 Release 5.9 accounting
CG15882 2008-12-18 5.12 accounting

Clone Sequence Records

IP04449.complete Sequence

653 bp (653 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023676

> IP04449.complete
CACGATTCAAGTGAGCTATTGCGAAATAAATTAAAAAACCAACTTTTCAA
TCTTCTGGGAATATTGAATACTGAGGAAAACCCTAAATTGATTGCTGCCG
AAACCCAGAAGGATGGAGAACATGAACAAAGAACTCGCGAATATGGAGAA
ACTATCTTTGAAGGAGCTGCTCAGTGAGGACACACTCTCTGAATTGGCTA
CCCCGAATGATGTCGACATTGCCGGCGAGGAAAAGAACCTCGAGGGTCAA
TCTGTTTCGAAGGAAGATCCACCGCCTGCGGCAGTTGTACCCAAAGCGAC
CAAAGCGCCCAATAATCCCGAAGCGCTAACCCAAAAGCAGAGTATGGACT
ATGCGGCACGGATCGTGAAGGTCATCAACCTACAGATGCAAAATGTGGTG
CATAAAACGTTCATGATGATGCAATCACCACTCCCTCTCCGGAACAGGCT
ACCAGTGGTCGTGTCCACCATGATCCGCTCCCGTAGGGCACCCAAGTTGA
AGCTCAAAGATGTGAGGAGAGTGATCACGGGCCTGGCGCTGCATCGTGCA
CACCTGGTCTACGAATATATTATCAACCACCCCGAATAAGAAAACTTCTA
CATATGTTAACTTAATACAATAATTAAAAAATCCAAAAAAAAAAAAAAAA
AAA

IP04449.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG15882-RA 637 CG15882-RA 1..637 1..637 3185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19012606..19013236 631..1 3020 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19123752..19124388 637..1 3185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:06
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19131850..19132486 637..1 3185 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:09:57 has no hits.

IP04449.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:10:39 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19012603..19013236 1..634 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:01 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..477 113..589 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:50 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..477 113..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:21 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..477 113..589 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:18 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..477 113..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:41 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..477 113..589 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:19 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..634 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:49 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..634 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:21 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..634 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:18 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..634 1..634 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:41 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
CG15882-RA 1..634 1..634 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:39 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
X 19123755..19124388 1..634 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:39 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
X 19123755..19124388 1..634 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:39 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
X 19123755..19124388 1..634 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:21 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19017788..19018421 1..634 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:50 Download gff for IP04449.complete
Subject Subject Range Query Range Percent Splice Strand
X 19131853..19132486 1..634 100   Minus

IP04449.pep Sequence

Translation from 112 to 588

> IP04449.pep
MENMNKELANMEKLSLKELLSEDTLSELATPNDVDIAGEEKNLEGQSVSK
EDPPPAAVVPKATKAPNNPEALTQKQSMDYAARIVKVINLQMQNVVHKTF
MMMQSPLPLRNRLPVVVSTMIRSRRAPKLKLKDVRRVITGLALHRAHLVY
EYIINHPE*

IP04449.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18082-PA 178 GG18082-PA 57..175 30..154 186 40.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15882-PA 158 CG15882-PA 1..158 1..158 792 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22771-PA 132 GM22771-PA 1..132 28..158 405 64.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24466-PA 59 GD24466-PA 1..59 101..158 146 59.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15480-PA 208 GE15480-PA 135..198 93..154 154 56.2 Plus

IP04449.hyp Sequence

Translation from 112 to 588

> IP04449.hyp
MENMNKELANMEKLSLKELLSEDTLSELATPNDVDIAGEEKNLEGQSVSK
EDPPPAAVVPKATKAPNNPEALTQKQSMDYAARIVKVINLQMQNVVHKTF
MMMQSPLPLRNRLPVVVSTMIRSRRAPKLKLKDVRRVITGLALHRAHLVY
EYIINHPE*

IP04449.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15882-PA 158 CG15882-PA 1..158 1..158 792 100 Plus