Clone IP04450 Report

Search the DGRC for IP04450

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:44
Well:50
Vector:pOT2
Associated Gene/TranscriptCG15908-RA
Protein status:IP04450.pep: gold
Preliminary Size:471
Sequenced Size:554

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15908 2005-01-01 Successful iPCR screen
CG15908 2008-04-29 Release 5.5 accounting
CG15908 2008-08-15 Release 5.9 accounting
CG9410 2008-08-15 Release 5.9 accounting
CG9410 2008-12-18 5.12 accounting
CG15908 2008-12-18 5.12 accounting

Clone Sequence Records

IP04450.complete Sequence

554 bp (554 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023673

> IP04450.complete
CTGTGCGGGCTAATGATTGATTTTATGTAATTGAAATGGCCACAAAATCG
GATAATGCTGACTCAAAATCGGACAAATCAAAGGAATCACTAGATGACGC
ATGGGCAATCCGACCCTGTCATCTGTACAAGGAGGAGTACGACGACTGCA
CGAGTTTTAAGGCGCGCTTCCACCAGTACTTTATATTTGGCAAGGACACA
GATTGCTCCCAATGGCTAACTGATTACCGTAACTGCGAACGATATCAGCA
GTCCAACGGGAACGATGTGGCTGCCGGCAAAGCGGTGATTAAAAGCGAGG
AGGAGCGCCGAAGGATCCGCCTGCGCGCCCACTTTGCCAACGACACTTGG
CAGAAGCGTAAGAAGCCACCGCTGGATTGGGCTGCTCCTCTGCCGGACTG
GATGGAGAAGCGAAACGAGAATACCTATCTTGAGCTTAAGCAAAAAGAGC
TCTCTGGACAGGCGGCGCCGCAAGGAGAGGAACGCTCGCTGTGCACGATC
ATGTGAAGATAAATAGTAAATTATTAGTTAAGAAAAGAAAAAAAAAAAAA
AAAA

IP04450.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15908-RA 537 CG15908-RA 1..537 1..537 2685 100 Plus
CG9410-RD 1442 CG9410-RD 1..515 1..515 2575 100 Plus
CG15908-RB 1442 CG15908-RB 1..515 1..515 2575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:26:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2555501..2555930 108..537 2150 100 Plus
chr2R 21145070 chr2R 2555342..2555448 1..107 535 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6668309..6668740 108..539 2160 100 Plus
2R 25286936 2R 6668150..6668256 1..107 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6669508..6669939 108..539 2160 100 Plus
2R 25260384 2R 6669349..6669455 1..107 535 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:26:27 has no hits.

IP04450.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:27:11 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2555342..2555448 1..107 100 -> Plus
chr2R 2555501..2555930 108..537 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:02 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RB 1..471 36..506 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:51 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RB 1..471 36..506 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:01:30 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RA 1..471 36..506 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:19 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RB 1..471 36..506 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:08:12 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RA 1..471 36..506 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:21 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RA 1..537 1..537 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:51 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RA 1..537 1..537 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:01:30 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RA 1..537 1..537 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:19 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RA 1..537 1..537 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:08:12 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
CG15908-RA 1..537 1..537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:11 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668150..6668256 1..107 100 -> Plus
2R 6668309..6668738 108..537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:11 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668150..6668256 1..107 100 -> Plus
2R 6668309..6668738 108..537 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:11 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6668150..6668256 1..107 100 -> Plus
2R 6668309..6668738 108..537 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:01:30 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2555655..2555761 1..107 100 -> Plus
arm_2R 2555814..2556243 108..537 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:51 Download gff for IP04450.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6669508..6669937 108..537 100   Plus
2R 6669349..6669455 1..107 100 -> Plus

IP04450.pep Sequence

Translation from 35 to 505

> IP04450.pep
MATKSDNADSKSDKSKESLDDAWAIRPCHLYKEEYDDCTSFKARFHQYFI
FGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEERRRIRLRAHF
ANDTWQKRKKPPLDWAAPLPDWMEKRNENTYLELKQKELSGQAAPQGEER
SLCTIM*

IP04450.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11061-PA 156 GF11061-PA 1..156 1..156 724 84.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23212-PA 156 GG23212-PA 1..156 1..156 787 91.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21744-PA 156 GH21744-PA 1..156 1..156 662 75 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG15908-PA 156 CG15908-PA 1..156 1..156 852 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19292-PA 156 GI19292-PA 1..156 1..156 638 73.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11109-PA 156 GL11109-PA 1..156 1..156 684 76.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14018-PA 156 GA14018-PA 1..156 1..156 682 76.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20886-PA 156 GM20886-PA 1..156 1..156 809 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10416-PA 156 GD10416-PA 1..156 1..156 819 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:11:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22168-PA 156 GJ22168-PA 1..156 1..156 638 73.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23086-PA 153 GK23086-PA 2..153 3..156 608 72.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19066-PA 156 GE19066-PA 1..156 1..156 755 95.5 Plus

IP04450.hyp Sequence

Translation from 35 to 505

> IP04450.hyp
MATKSDNADSKSDKSKESLDDAWAIRPCHLYKEEYDDCTSFKARFHQYFI
FGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEERRRIRLRAHF
ANDTWQKRKKPPLDWAAPLPDWMEKRNENTYLELKQKELSGQAAPQGEER
SLCTIM*

IP04450.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG15908-PA 156 CG15908-PA 1..156 1..156 852 100 Plus