BDGP Sequence Production Resources |
Search the DGRC for IP04450
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 44 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15908-RA |
Protein status: | IP04450.pep: gold |
Preliminary Size: | 471 |
Sequenced Size: | 554 |
Gene | Date | Evidence |
---|---|---|
CG15908 | 2005-01-01 | Successful iPCR screen |
CG15908 | 2008-04-29 | Release 5.5 accounting |
CG15908 | 2008-08-15 | Release 5.9 accounting |
CG9410 | 2008-08-15 | Release 5.9 accounting |
CG9410 | 2008-12-18 | 5.12 accounting |
CG15908 | 2008-12-18 | 5.12 accounting |
554 bp (554 high quality bases) assembled on 2005-01-04
GenBank Submission: BT023673
> IP04450.complete CTGTGCGGGCTAATGATTGATTTTATGTAATTGAAATGGCCACAAAATCG GATAATGCTGACTCAAAATCGGACAAATCAAAGGAATCACTAGATGACGC ATGGGCAATCCGACCCTGTCATCTGTACAAGGAGGAGTACGACGACTGCA CGAGTTTTAAGGCGCGCTTCCACCAGTACTTTATATTTGGCAAGGACACA GATTGCTCCCAATGGCTAACTGATTACCGTAACTGCGAACGATATCAGCA GTCCAACGGGAACGATGTGGCTGCCGGCAAAGCGGTGATTAAAAGCGAGG AGGAGCGCCGAAGGATCCGCCTGCGCGCCCACTTTGCCAACGACACTTGG CAGAAGCGTAAGAAGCCACCGCTGGATTGGGCTGCTCCTCTGCCGGACTG GATGGAGAAGCGAAACGAGAATACCTATCTTGAGCTTAAGCAAAAAGAGC TCTCTGGACAGGCGGCGCCGCAAGGAGAGGAACGCTCGCTGTGCACGATC ATGTGAAGATAAATAGTAAATTATTAGTTAAGAAAAGAAAAAAAAAAAAA AAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 2555342..2555448 | 1..107 | 100 | -> | Plus |
chr2R | 2555501..2555930 | 108..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RB | 1..471 | 36..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RB | 1..471 | 36..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RA | 1..471 | 36..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RB | 1..471 | 36..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RA | 1..471 | 36..506 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RA | 1..537 | 1..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RA | 1..537 | 1..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RA | 1..537 | 1..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RA | 1..537 | 1..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15908-RA | 1..537 | 1..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6668150..6668256 | 1..107 | 100 | -> | Plus |
2R | 6668309..6668738 | 108..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6668150..6668256 | 1..107 | 100 | -> | Plus |
2R | 6668309..6668738 | 108..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6668150..6668256 | 1..107 | 100 | -> | Plus |
2R | 6668309..6668738 | 108..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 2555655..2555761 | 1..107 | 100 | -> | Plus |
arm_2R | 2555814..2556243 | 108..537 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6669508..6669937 | 108..537 | 100 | Plus | |
2R | 6669349..6669455 | 1..107 | 100 | -> | Plus |
Translation from 35 to 505
> IP04450.pep MATKSDNADSKSDKSKESLDDAWAIRPCHLYKEEYDDCTSFKARFHQYFI FGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEERRRIRLRAHF ANDTWQKRKKPPLDWAAPLPDWMEKRNENTYLELKQKELSGQAAPQGEER SLCTIM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11061-PA | 156 | GF11061-PA | 1..156 | 1..156 | 724 | 84.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23212-PA | 156 | GG23212-PA | 1..156 | 1..156 | 787 | 91.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21744-PA | 156 | GH21744-PA | 1..156 | 1..156 | 662 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15908-PA | 156 | CG15908-PA | 1..156 | 1..156 | 852 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19292-PA | 156 | GI19292-PA | 1..156 | 1..156 | 638 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11109-PA | 156 | GL11109-PA | 1..156 | 1..156 | 684 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14018-PA | 156 | GA14018-PA | 1..156 | 1..156 | 682 | 76.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20886-PA | 156 | GM20886-PA | 1..156 | 1..156 | 809 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10416-PA | 156 | GD10416-PA | 1..156 | 1..156 | 819 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22168-PA | 156 | GJ22168-PA | 1..156 | 1..156 | 638 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23086-PA | 153 | GK23086-PA | 2..153 | 3..156 | 608 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19066-PA | 156 | GE19066-PA | 1..156 | 1..156 | 755 | 95.5 | Plus |
Translation from 35 to 505
> IP04450.hyp MATKSDNADSKSDKSKESLDDAWAIRPCHLYKEEYDDCTSFKARFHQYFI FGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEERRRIRLRAHF ANDTWQKRKKPPLDWAAPLPDWMEKRNENTYLELKQKELSGQAAPQGEER SLCTIM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15908-PA | 156 | CG15908-PA | 1..156 | 1..156 | 852 | 100 | Plus |