Clone IP04461 Report

Search the DGRC for IP04461

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:44
Well:61
Vector:pOT2
Associated Gene/TranscriptCG17625-RA
Protein status:IP04461.pep: gold
Preliminary Size:429
Sequenced Size:577

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17625 2005-01-01 Successful iPCR screen
CG17625 2008-04-29 Release 5.5 accounting
CG17625 2008-08-15 Release 5.9 accounting
CG17625 2008-12-18 5.12 accounting

Clone Sequence Records

IP04461.complete Sequence

577 bp (577 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023674

> IP04461.complete
CTGTTGTTTAAAGTGTTCAATTTGGAGATTTAGAGATTATAATAGAAGAA
CTAGGATGTGTGGACGGGCTGTGCGCGATTGGTTGGTGCTATTGACCATG
GAGAAGTACATTGGTAAATTCCTGGAGCGGGGGTACGACAGCATTGAACG
CTGCAAGCTTATTATCGTAAGCGATCTGATCATGCTGGGAGTGGATAATC
CCGCTCATAGGAAGCTCCTGCTCGAGGGAGTCCGGTTCTTGGTCAACGCA
CCCGAGCAGTTCATCTGCAAGGAGCCGTGTGAGCTGCATGAGGAGATTGA
ACTGAAATTAGACCCGGATGTTGAGTTGTTTGCTTCGCTAAAGTGCCTGG
AAAATGTTGATTTCCTAGAAACACCTGTTCCATATTCGCTAACATCTCCA
CAAAAGACGCTCACAACTCGGGACTCTTGCAAATGGAATGTCAAAGGTGT
GGATCAGTTACCTTCCGATAACATATTTAACTAAATACAAACAAAGCAAA
AAATAATGCGTGTGATAAGGATCTTTATATATTTTTAAGAACCAATAAAA
CGACAATTGAAAAAAAAAAAAAAAAAA

IP04461.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG17625-RA 563 CG17625-RA 1..563 1..563 2815 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18510358..18510908 1..551 2680 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:53:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22686849..22687411 1..563 2815 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22427680..22428242 1..563 2815 100 Plus
Blast to na_te.dros performed 2019-03-16 03:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 13308..13378 488..557 109 65.3 Plus

IP04461.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:53:59 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18510358..18510913 1..559 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:04 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..429 56..484 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:45:44 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..429 56..484 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:42 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..429 56..484 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:27:13 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..429 56..484 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:18:40 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..429 56..484 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:19:00 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..559 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:45:44 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..559 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:42 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..559 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:27:13 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..559 1..559 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:18:40 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
CG17625-RA 1..559 1..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:53:59 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22686849..22687407 1..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:53:59 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22686849..22687407 1..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:53:59 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22686849..22687407 1..559 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:42 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18512571..18513129 1..559 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:06:23 Download gff for IP04461.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22427680..22428238 1..559 100   Plus

IP04461.hyp Sequence

Translation from 0 to 483

> IP04461.hyp
CCLKCSIWRFRDYNRRTRMCGRAVRDWLVLLTMEKYIGKFLERGYDSIER
CKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQFICKEPCELHEEIE
LKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKTLTTRDSCKWNVKGV
DQLPSDNIFN*

IP04461.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG17625-PA 142 CG17625-PA 1..142 19..160 751 100 Plus
SKIP-PH 128 CG31163-PH 7..118 24..129 137 36.6 Plus

IP04461.pep Sequence

Translation from 55 to 483

> IP04461.pep
MCGRAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPA
HRKLLLEGVRFLVNAPEQFICKEPCELHEEIELKLDPDVELFASLKCLEN
VDFLETPVPYSLTSPQKTLTTRDSCKWNVKGVDQLPSDNIFN*

IP04461.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17002-PA 216 GF17002-PA 1..86 1..86 336 69.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11157-PA 146 GG11157-PA 1..139 1..137 477 68.6 Plus
Dere\GG11112-PA 126 GG11112-PA 9..121 8..116 137 36.5 Plus
Dere\GG12531-PA 138 GG12531-PA 9..63 8..62 132 49.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19197-PA 150 GH19197-PA 1..96 1..96 299 55.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG17625-PA 142 CG17625-PA 1..142 1..142 751 100 Plus
SKIP-PH 128 CG31163-PH 7..118 6..111 137 36.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21402-PA 196 GI21402-PA 1..78 1..78 280 61.5 Plus
Dmoj\GI10467-PA 121 GI10467-PA 9..87 8..83 136 39.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24315-PA 199 GL24315-PA 1..76 1..76 261 57.9 Plus
Dper\GL23209-PA 133 GL23209-PA 9..87 8..83 133 36.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14584-PA 197 GA14584-PA 1..66 15..80 194 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26457-PA 140 GM26457-PA 1..140 1..142 618 85.2 Plus
Dsec\GM26407-PA 151 GM26407-PA 9..127 8..122 139 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:40:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20973-PA 132 GD20973-PA 1..132 1..134 595 87.3 Plus
Dsim\GD20927-PA 126 GD20927-PA 9..121 8..116 137 36.5 Plus
Dsim\GD18474-PA 127 GD18474-PA 9..63 8..62 132 49.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10459-PA 200 GJ10459-PA 1..78 1..78 289 64.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10322-PA 149 GE10322-PA 1..142 1..140 495 68.5 Plus
Dyak\GE10275-PA 167 GE10275-PA 9..118 8..111 138 36.4 Plus