BDGP Sequence Production Resources |
Search the DGRC for IP04461
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 44 |
Well: | 61 |
Vector: | pOT2 |
Associated Gene/Transcript | CG17625-RA |
Protein status: | IP04461.pep: gold |
Preliminary Size: | 429 |
Sequenced Size: | 577 |
Gene | Date | Evidence |
---|---|---|
CG17625 | 2005-01-01 | Successful iPCR screen |
CG17625 | 2008-04-29 | Release 5.5 accounting |
CG17625 | 2008-08-15 | Release 5.9 accounting |
CG17625 | 2008-12-18 | 5.12 accounting |
577 bp (577 high quality bases) assembled on 2005-01-04
GenBank Submission: BT023674
> IP04461.complete CTGTTGTTTAAAGTGTTCAATTTGGAGATTTAGAGATTATAATAGAAGAA CTAGGATGTGTGGACGGGCTGTGCGCGATTGGTTGGTGCTATTGACCATG GAGAAGTACATTGGTAAATTCCTGGAGCGGGGGTACGACAGCATTGAACG CTGCAAGCTTATTATCGTAAGCGATCTGATCATGCTGGGAGTGGATAATC CCGCTCATAGGAAGCTCCTGCTCGAGGGAGTCCGGTTCTTGGTCAACGCA CCCGAGCAGTTCATCTGCAAGGAGCCGTGTGAGCTGCATGAGGAGATTGA ACTGAAATTAGACCCGGATGTTGAGTTGTTTGCTTCGCTAAAGTGCCTGG AAAATGTTGATTTCCTAGAAACACCTGTTCCATATTCGCTAACATCTCCA CAAAAGACGCTCACAACTCGGGACTCTTGCAAATGGAATGTCAAAGGTGT GGATCAGTTACCTTCCGATAACATATTTAACTAAATACAAACAAAGCAAA AAATAATGCGTGTGATAAGGATCTTTATATATTTTTAAGAACCAATAAAA CGACAATTGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17625-RA | 563 | CG17625-RA | 1..563 | 1..563 | 2815 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 18510358..18510908 | 1..551 | 2680 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 22686849..22687411 | 1..563 | 2815 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 22427680..22428242 | 1..563 | 2815 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TART-A | 13424 | TART-A 13424bp | 13308..13378 | 488..557 | 109 | 65.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 18510358..18510913 | 1..559 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..429 | 56..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..429 | 56..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..429 | 56..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..429 | 56..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..429 | 56..484 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..559 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..559 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..559 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..559 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17625-RA | 1..559 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22686849..22687407 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22686849..22687407 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22686849..22687407 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 18512571..18513129 | 1..559 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 22427680..22428238 | 1..559 | 100 | Plus |
Translation from 0 to 483
> IP04461.hyp CCLKCSIWRFRDYNRRTRMCGRAVRDWLVLLTMEKYIGKFLERGYDSIER CKLIIVSDLIMLGVDNPAHRKLLLEGVRFLVNAPEQFICKEPCELHEEIE LKLDPDVELFASLKCLENVDFLETPVPYSLTSPQKTLTTRDSCKWNVKGV DQLPSDNIFN*
Translation from 55 to 483
> IP04461.pep MCGRAVRDWLVLLTMEKYIGKFLERGYDSIERCKLIIVSDLIMLGVDNPA HRKLLLEGVRFLVNAPEQFICKEPCELHEEIELKLDPDVELFASLKCLEN VDFLETPVPYSLTSPQKTLTTRDSCKWNVKGVDQLPSDNIFN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17002-PA | 216 | GF17002-PA | 1..86 | 1..86 | 336 | 69.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11157-PA | 146 | GG11157-PA | 1..139 | 1..137 | 477 | 68.6 | Plus |
Dere\GG11112-PA | 126 | GG11112-PA | 9..121 | 8..116 | 137 | 36.5 | Plus |
Dere\GG12531-PA | 138 | GG12531-PA | 9..63 | 8..62 | 132 | 49.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19197-PA | 150 | GH19197-PA | 1..96 | 1..96 | 299 | 55.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17625-PA | 142 | CG17625-PA | 1..142 | 1..142 | 751 | 100 | Plus |
SKIP-PH | 128 | CG31163-PH | 7..118 | 6..111 | 137 | 36.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21402-PA | 196 | GI21402-PA | 1..78 | 1..78 | 280 | 61.5 | Plus |
Dmoj\GI10467-PA | 121 | GI10467-PA | 9..87 | 8..83 | 136 | 39.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24315-PA | 199 | GL24315-PA | 1..76 | 1..76 | 261 | 57.9 | Plus |
Dper\GL23209-PA | 133 | GL23209-PA | 9..87 | 8..83 | 133 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14584-PA | 197 | GA14584-PA | 1..66 | 15..80 | 194 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26457-PA | 140 | GM26457-PA | 1..140 | 1..142 | 618 | 85.2 | Plus |
Dsec\GM26407-PA | 151 | GM26407-PA | 9..127 | 8..122 | 139 | 35.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20973-PA | 132 | GD20973-PA | 1..132 | 1..134 | 595 | 87.3 | Plus |
Dsim\GD20927-PA | 126 | GD20927-PA | 9..121 | 8..116 | 137 | 36.5 | Plus |
Dsim\GD18474-PA | 127 | GD18474-PA | 9..63 | 8..62 | 132 | 49.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10459-PA | 200 | GJ10459-PA | 1..78 | 1..78 | 289 | 64.1 | Plus |