Clone IP04473 Report

Search the DGRC for IP04473

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:44
Well:73
Vector:pOT2
Associated Gene/TranscriptCG30369-RA
Protein status:IP04473.pep: gold
Preliminary Size:453
Sequenced Size:474

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30369 2005-01-01 Successful iPCR screen
CG30369 2008-04-29 Release 5.5 accounting
CG30369 2008-08-15 Release 5.9 accounting
CG30369 2008-12-18 5.12 accounting

Clone Sequence Records

IP04473.complete Sequence

474 bp (474 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023671

> IP04473.complete
AGAAACCCTAGTTTATCTTTTTGGCTTCGATTAAATTTGAAATATCAGTC
AACGTATTTTTAAGCCCCGAACCTGCAGCCATGATGTCCTTTGGTCGAGT
TCTCGGGGGCCTATCCGTTTTACATTTTTCCCGGAACAGAAGTTTGCATC
AAAGGAGGACGAGGCGACCATTTCCTGTAGTTCCCGACGCGAGGATTAAG
ACCCCGGCGCAATCAACCCGACCACCCCGCATCCTGGTGAAGAGCTTCTT
GGCCCTCCATCATCTGGATTCTGTGTACATGCAGGGTGCTCCTCGTGATC
TTAGAGACTATTTTATGTCAAGCTGGAAAAACGAGAGAAAATGATATCCC
CCCTTGACTTTACCATTCGTAACCATGGGAATCGCCCTTGCGGTCAATAT
TAAAAATTTAAAGTTTTTGGAAAAAATACTGTTCTAAAAATATATTACGT
TATTCGACAAAAAAAAAAAAAAAA

IP04473.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG30369-RA 458 CG30369-RA 1..458 1..458 2290 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4146822..4147279 1..458 2260 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8259327..8259784 1..458 2290 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8260526..8260983 1..458 2290 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:28:08 has no hits.

IP04473.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:29:09 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4146822..4147279 1..458 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:09 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 1..264 81..344 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:35 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 1..264 81..344 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:11:53 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 1..264 81..344 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:32 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 1..264 81..344 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:46 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 1..264 81..344 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:44 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:35 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 17..474 1..458 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:11:53 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 42..499 1..458 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:33 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 1..453 5..457 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:46 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
CG30369-RA 42..499 1..458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:09 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8259327..8259784 1..458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:09 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8259327..8259784 1..458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:09 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8259327..8259784 1..458 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:11:53 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4146832..4147289 1..458 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:48 Download gff for IP04473.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8260526..8260983 1..458 100   Plus

IP04473.pep Sequence

Translation from 80 to 343

> IP04473.pep
MMSFGRVLGGLSVLHFSRNRSLHQRRTRRPFPVVPDARIKTPAQSTRPPR
ILVKSFLALHHLDSVYMQGAPRDLRDYFMSSWKNERK*

IP04473.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19795-PA 84 GF19795-PA 1..82 2..83 216 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23347-PA 84 GG23347-PA 1..84 1..87 344 78.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG30369-PA 87 CG30369-PA 1..87 1..87 456 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21019-PA 87 GM21019-PA 1..87 1..87 429 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10553-PA 87 GD10553-PA 1..87 1..87 429 94.3 Plus
Dsim\GD14247-PA 87 GD14247-PA 1..87 1..87 429 94.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19187-PA 87 GE19187-PA 1..87 1..87 377 79.3 Plus

IP04473.hyp Sequence

Translation from 80 to 343

> IP04473.hyp
MMSFGRVLGGLSVLHFSRNRSLHQRRTRRPFPVVPDARIKTPAQSTRPPR
ILVKSFLALHHLDSVYMQGAPRDLRDYFMSSWKNERK*

IP04473.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG30369-PA 87 CG30369-PA 1..87 1..87 456 100 Plus