IP04473.complete Sequence
474 bp (474 high quality bases) assembled on 2005-01-04
GenBank Submission: BT023671
> IP04473.complete
AGAAACCCTAGTTTATCTTTTTGGCTTCGATTAAATTTGAAATATCAGTC
AACGTATTTTTAAGCCCCGAACCTGCAGCCATGATGTCCTTTGGTCGAGT
TCTCGGGGGCCTATCCGTTTTACATTTTTCCCGGAACAGAAGTTTGCATC
AAAGGAGGACGAGGCGACCATTTCCTGTAGTTCCCGACGCGAGGATTAAG
ACCCCGGCGCAATCAACCCGACCACCCCGCATCCTGGTGAAGAGCTTCTT
GGCCCTCCATCATCTGGATTCTGTGTACATGCAGGGTGCTCCTCGTGATC
TTAGAGACTATTTTATGTCAAGCTGGAAAAACGAGAGAAAATGATATCCC
CCCTTGACTTTACCATTCGTAACCATGGGAATCGCCCTTGCGGTCAATAT
TAAAAATTTAAAGTTTTTGGAAAAAATACTGTTCTAAAAATATATTACGT
TATTCGACAAAAAAAAAAAAAAAA
IP04473.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:16:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-RA | 458 | CG30369-RA | 1..458 | 1..458 | 2290 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:28:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 4146822..4147279 | 1..458 | 2260 | 99.6 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:28:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 8259327..8259784 | 1..458 | 2290 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 8260526..8260983 | 1..458 | 2290 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 19:28:08 has no hits.
IP04473.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:29:09 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 4146822..4147279 | 1..458 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:09 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..264 | 81..344 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:35 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..264 | 81..344 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:11:53 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..264 | 81..344 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:32 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..264 | 81..344 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:46 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..264 | 81..344 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:59:44 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..453 | 5..457 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:35 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 17..474 | 1..458 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:11:53 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 42..499 | 1..458 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:33 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 1..453 | 5..457 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:46 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30369-RA | 42..499 | 1..458 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:09 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259327..8259784 | 1..458 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:09 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259327..8259784 | 1..458 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:09 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8259327..8259784 | 1..458 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:11:53 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 4146832..4147289 | 1..458 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:48 Download gff for
IP04473.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 8260526..8260983 | 1..458 | 100 | | Plus |
IP04473.pep Sequence
Translation from 80 to 343
> IP04473.pep
MMSFGRVLGGLSVLHFSRNRSLHQRRTRRPFPVVPDARIKTPAQSTRPPR
ILVKSFLALHHLDSVYMQGAPRDLRDYFMSSWKNERK*
IP04473.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:35:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19795-PA | 84 | GF19795-PA | 1..82 | 2..83 | 216 | 50 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:35:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23347-PA | 84 | GG23347-PA | 1..84 | 1..87 | 344 | 78.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-PA | 87 | CG30369-PA | 1..87 | 1..87 | 456 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:35:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21019-PA | 87 | GM21019-PA | 1..87 | 1..87 | 429 | 94.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:35:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10553-PA | 87 | GD10553-PA | 1..87 | 1..87 | 429 | 94.3 | Plus |
Dsim\GD14247-PA | 87 | GD14247-PA | 1..87 | 1..87 | 429 | 94.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:35:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE19187-PA | 87 | GE19187-PA | 1..87 | 1..87 | 377 | 79.3 | Plus |
IP04473.hyp Sequence
Translation from 80 to 343
> IP04473.hyp
MMSFGRVLGGLSVLHFSRNRSLHQRRTRRPFPVVPDARIKTPAQSTRPPR
ILVKSFLALHHLDSVYMQGAPRDLRDYFMSSWKNERK*
IP04473.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30369-PA | 87 | CG30369-PA | 1..87 | 1..87 | 456 | 100 | Plus |