Clone IP04502 Report

Search the DGRC for IP04502

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:2
Vector:pOT2
Associated Gene/TranscriptCG14515-RA
Protein status:IP04502.pep: gold
Preliminary Size:438
Sequenced Size:631

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14515 2005-01-01 Successful iPCR screen
CG14515 2008-04-29 Release 5.5 accounting
CG14515 2008-08-15 Release 5.9 accounting
CG14515 2008-12-18 5.12 accounting

Clone Sequence Records

IP04502.complete Sequence

631 bp (631 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023669

> IP04502.complete
CGAGAGCGCGCGCGTTTTTTCCCACGATCAGGAAAATCGAATTCCAGAGC
CATGAAGGATCGATTCAAGTGGTTGTCGCTGGAGCTGCTCCTGCTGATAG
GCGCCGCAGTCGCCTTTCCGGACGGCGCTCCGGCGGACACGTGCGTGAAG
CAGCGGGCGAATCAGCCGAATCATGGCAAGGCCCGGAGTCAGCCGGCTCA
CTCGAATCCGTACGAGGTGGTGGCCGATGCGCAGACCTACCATCCCGGCC
AGCAGATATCGGTGGTCATCTACCCGCACTCGGACCAGAGCACCGTCTTC
CGGGGATTTTTCCTGCAGGCGCGTGATGCCAACTCGAACGAGTGGATCGG
CGAGTGGGTGCAGAGCGAGAACACCAAGACCATTCCAGAGTGCTCGGCCA
TTACGCACTCGGACAACCGGGACAAGCTGGGCGCCAAGCTCATCTGGAAG
GCACCGCAAAATAAGCGGGGACAAGTCTACTTCACGGGCACTGTGCTACA
GGAGTACGGAACGTTTTGGAGCGACATTGTGAACAAAGTGCAGGCGGAGC
GGCCATAACTGAAATTATGTACTTACTTTTAAGGCAGCCGGGCAATAAAT
CTTAAAAACCCTAAAAAAAAAAAAAAAAAAA

IP04502.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:27:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14515-RA 878 CG14515-RA 135..748 1..614 3055 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25020405..25020890 1..486 2325 98.6 Plus
chr3R 27901430 chr3R 25021911..25022037 486..612 635 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29197583..29198068 1..486 2415 99.8 Plus
3R 32079331 3R 29199085..29199213 486..614 645 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 28938414..28938899 1..486 2415 99.7 Plus
3R 31820162 3R 28939916..28940044 486..614 645 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:42:05 has no hits.

IP04502.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:43:09 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25020405..25020889 1..485 98 -> Plus
chr3R 25021911..25022037 486..612 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:17 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..507 52..558 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:49:42 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..507 52..558 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:57:14 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..507 52..558 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:30:30 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..507 52..558 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:17 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..507 52..558 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:22:54 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..612 1..612 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:49:42 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..612 1..612 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:57:14 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 28..639 1..612 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:30:30 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 1..612 1..612 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:17 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
CG14515-RA 28..639 1..612 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:09 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29197583..29198067 1..485 99 -> Plus
3R 29199085..29199211 486..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:09 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29197583..29198067 1..485 99 -> Plus
3R 29199085..29199211 486..612 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:09 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29197583..29198067 1..485 99 -> Plus
3R 29199085..29199211 486..612 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:57:14 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25023305..25023789 1..485 99 -> Plus
arm_3R 25024807..25024933 486..612 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:08:54 Download gff for IP04502.complete
Subject Subject Range Query Range Percent Splice Strand
3R 28938414..28938898 1..485 99 -> Plus
3R 28939916..28940042 486..612 100   Plus

IP04502.hyp Sequence

Translation from 0 to 557

> IP04502.hyp
RERARFFPRSGKSNSRAMKDRFKWLSLELLLLIGAAVAFPDGAPADTCVK
QRANQPNHGKARSQPAHSNPYEVVADAQTYHPGQQISVVIYPHSDQSTVF
RGFFLQARDANSNEWIGEWVQSENTKTIPECSAITHSDNRDKLGAKLIWK
APQNKRGQVYFTGTVLQEYGTFWSDIVNKVQAERP*

IP04502.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14515-PA 168 CG14515-PA 1..168 18..185 901 100 Plus

IP04502.pep Sequence

Translation from 51 to 557

> IP04502.pep
MKDRFKWLSLELLLLIGAAVAFPDGAPADTCVKQRANQPNHGKARSQPAH
SNPYEVVADAQTYHPGQQISVVIYPHSDQSTVFRGFFLQARDANSNEWIG
EWVQSENTKTIPECSAITHSDNRDKLGAKLIWKAPQNKRGQVYFTGTVLQ
EYGTFWSDIVNKVQAERP*

IP04502.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16605-PA 123 GF16605-PA 1..121 1..166 514 63.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11652-PA 168 GG11652-PA 1..167 1..167 852 93.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14301-PA 175 GH14301-PA 28..173 22..166 680 86.3 Plus
Dgri\GH22061-PA 646 GH22061-PA 15..179 8..167 141 28.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14515-PA 168 CG14515-PA 1..168 1..168 901 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10398-PA 173 GI10398-PA 11..169 9..166 710 83.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13879-PA 177 GL13879-PA 1..175 1..166 774 84 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13046-PA 177 GA13046-PA 1..175 1..166 774 84 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12774-PA 168 GM12774-PA 1..168 1..168 902 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21425-PA 156 GD21425-PA 1..156 1..168 729 88.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14512-PA 173 GJ14512-PA 20..171 16..166 688 82.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22669-PA 173 GK22669-PA 2..172 4..168 736 81.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23843-PA 168 GE23843-PA 1..167 1..167 879 97 Plus