Clone IP04504 Report

Search the DGRC for IP04504

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:4
Vector:pOT2
Associated Gene/TranscriptCG14628-RA
Protein status:IP04504.pep: gold
Preliminary Size:426
Sequenced Size:509

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14628 2005-01-01 Successful iPCR screen
CG14628 2008-04-29 Release 5.5 accounting
CG14628 2008-08-15 Release 5.9 accounting
CG14628 2008-12-18 5.12 accounting

Clone Sequence Records

IP04504.complete Sequence

509 bp (509 high quality bases) assembled on 2005-01-04

GenBank Submission: BT023670

> IP04504.complete
ATTCAACAGAGTAAAAATAAAATAGAAATATATAATGTCTGCAAGTGATA
TCGCGGGAATTGAACTCACCAGTGGACCGACTGGTCTGAAGAGCAGGATC
CTTGTGAGAAACCTTCCGGTATGCACCCGCCAGGAGCTGGCTTACCTCTG
CTTGCCCTTCGGCGAAATCCTTGGCTCGCTGGTCACCAATAACCAGGGGT
TTATCCAGTTCGCTAGGGAGAGCGAGGCCAAGCTCGCCATAGAGACGCTC
GACCATACTACCTTCAAATCTAAGGTTATCCTTGTTTCGAACGCAAGCTT
CCGTTCGCTCAACGCCAGTTGCTTGGGCTATGCTCCCCCGGGGCAGATGA
TGATCGAGTGGTCTGATGAGGATGACGTCGATGAATACGATGATTACTCC
GAAAGTGATGACGAAGATGGCCCGGGAGACATGCAACTGTATAATGCTAA
TTTTATATAAACACTTATCAATAAAGTGTATTACAGTTTAAAAAAAAAAA
AAAAAAAAA

IP04504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-RA 491 CG14628-RA 1..491 1..491 2455 100 Plus
fz3-RB 2251 fz3-RB 1..306 35..340 855 85.2 Plus
CG18823-RA 321 CG18823-RA 24..242 76..294 495 81.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1039608..1040096 1..489 2430 99.8 Plus
chrX 22417052 chrX 671749..672129 1..378 940 83.7 Plus
chrX 22417052 chrX 21017528..21017893 375..10 585 77.3 Minus
chrX 22417052 chrX 21028704..21029069 375..10 585 77.3 Minus
chrU 10048995 chrU 5575462..5575827 375..10 585 77.3 Minus
chrX 22417052 chrX 884587..884805 76..294 510 82.2 Plus
chrU 10048995 chrU 8591052..8591222 10..180 450 84.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:06:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1145644..1146134 1..491 2455 100 Plus
X 23542271 X 777763..778143 1..378 940 83.7 Plus
X 23542271 X 21152371..21152736 375..10 585 77.3 Minus
X 23542271 X 21163547..21163912 375..10 585 77.3 Minus
X 23542271 X 990605..990823 76..294 495 81.7 Plus
U 3151297 U 3102315..3102485 10..180 450 84.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 1153742..1154232 1..491 2455 100 Plus
X 23527363 X 785861..786200 1..340 920 84.7 Plus
X 23527363 X 998703..998921 76..294 495 81.7 Plus
X 23527363 X 21137655..21137828 183..10 465 84.4 Minus
X 23527363 X 21148831..21149004 183..10 465 84.4 Minus
Blast to na_te.dros performed on 2019-03-15 19:06:46 has no hits.

IP04504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:07:33 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1039608..1040096 1..489 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:21 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..426 35..460 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:34:22 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..426 35..460 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:41:56 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..426 35..460 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:08:28 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..426 35..460 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:10:04 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..426 35..460 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:38 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..489 1..489 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:34:21 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..489 1..489 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:41:56 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..489 1..489 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:08:29 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..489 1..489 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:10:04 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
CG14628-RA 1..489 1..489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:33 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
X 1145644..1146132 1..489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:33 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
X 1145644..1146132 1..489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:07:33 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
X 1145644..1146132 1..489 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:41:56 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1039677..1040165 1..489 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:26 Download gff for IP04504.complete
Subject Subject Range Query Range Percent Splice Strand
X 1153742..1154230 1..489 100   Plus

IP04504.pep Sequence

Translation from 34 to 459

> IP04504.pep
MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLV
TNNQGFIQFARESEAKLAIETLDHTTFKSKVILVSNASFRSLNASCLGYA
PPGQMMIEWSDEDDVDEYDDYSESDDEDGPGDMQLYNANFI*

IP04504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23867-PA 366 GF23867-PA 2..86 4..88 203 44.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12822-PA 204 GG12822-PA 1..115 1..115 429 69.8 Plus
Dere\GG14412-PA 371 GG14412-PA 1..104 1..104 227 45.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:14:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15151-PA 375 GH15151-PA 11..94 8..91 188 42.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-PA 141 CG14628-PA 1..141 1..141 729 100 Plus
fz3-PB 646 CG16785-PB 1..137 1..129 439 68.6 Plus
CG18823-PA 106 CG18823-PA 9..106 15..121 285 57 Plus
Neos-PB 371 CG8614-PB 1..97 1..97 217 45.4 Plus
Neos-PA 371 CG8614-PA 1..97 1..97 217 45.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12088-PA 378 GI12088-PA 10..94 7..91 206 45.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24901-PA 374 GL24901-PA 16..88 18..90 197 50.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:14:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21209-PA 374 GA21209-PA 16..89 18..91 198 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18998-PA 141 GM18998-PA 1..141 1..141 508 83 Plus
Dsec\GM19114-PA 141 GM19114-PA 1..141 1..141 508 83 Plus
Dsec\GM19098-PA 186 GM19098-PA 1..115 1..115 372 64.3 Plus
Dsec\GM19104-PA 117 GM19104-PA 1..116 1..125 360 59.2 Plus
Dsec\GM19027-PA 184 GM19027-PA 1..115 1..115 353 61.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16527-PA 162 GD16527-PA 1..116 1..115 440 73.3 Plus
Dsim\GD16538-PA 121 GD16538-PA 1..115 1..125 376 63.2 Plus
Dsim\GD16533-PA 183 GD16533-PA 1..115 1..115 371 64.3 Plus
Dsim\GD16464-PA 184 GD16464-PA 1..115 1..115 348 61.7 Plus
Dsim\GD16465-PA 230 GD16465-PA 106..196 25..115 256 56 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13359-PA 375 GJ13359-PA 11..99 8..94 203 44.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:14:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13148-PA 371 GK13148-PA 10..93 7..90 194 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16653-PA 111 GE16653-PA 1..110 1..115 371 63.5 Plus
Dyak\GE16652-PA 105 GE16652-PA 1..103 1..103 365 67 Plus
Dyak\GE21602-PA 371 GE21602-PA 1..104 1..104 228 45.2 Plus

IP04504.hyp Sequence

Translation from 34 to 459

> IP04504.hyp
MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLV
TNNQGFIQFARESEAKLAIETLDHTTFKSKVILVSNASFRSLNASCLGYA
PPGQMMIEWSDEDDVDEYDDYSESDDEDGPGDMQLYNANFI*

IP04504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14628-PA 141 CG14628-PA 1..141 1..141 729 100 Plus
fz3-PB 646 CG16785-PB 1..137 1..129 439 68.6 Plus
CG18823-PA 106 CG18823-PA 9..106 15..121 285 57 Plus
Neos-PB 371 CG8614-PB 1..97 1..97 217 45.4 Plus
Neos-PA 371 CG8614-PA 1..97 1..97 217 45.4 Plus