BDGP Sequence Production Resources |
Search the DGRC for IP04504
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 45 |
Well: | 4 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14628-RA |
Protein status: | IP04504.pep: gold |
Preliminary Size: | 426 |
Sequenced Size: | 509 |
Gene | Date | Evidence |
---|---|---|
CG14628 | 2005-01-01 | Successful iPCR screen |
CG14628 | 2008-04-29 | Release 5.5 accounting |
CG14628 | 2008-08-15 | Release 5.9 accounting |
CG14628 | 2008-12-18 | 5.12 accounting |
509 bp (509 high quality bases) assembled on 2005-01-04
GenBank Submission: BT023670
> IP04504.complete ATTCAACAGAGTAAAAATAAAATAGAAATATATAATGTCTGCAAGTGATA TCGCGGGAATTGAACTCACCAGTGGACCGACTGGTCTGAAGAGCAGGATC CTTGTGAGAAACCTTCCGGTATGCACCCGCCAGGAGCTGGCTTACCTCTG CTTGCCCTTCGGCGAAATCCTTGGCTCGCTGGTCACCAATAACCAGGGGT TTATCCAGTTCGCTAGGGAGAGCGAGGCCAAGCTCGCCATAGAGACGCTC GACCATACTACCTTCAAATCTAAGGTTATCCTTGTTTCGAACGCAAGCTT CCGTTCGCTCAACGCCAGTTGCTTGGGCTATGCTCCCCCGGGGCAGATGA TGATCGAGTGGTCTGATGAGGATGACGTCGATGAATACGATGATTACTCC GAAAGTGATGACGAAGATGGCCCGGGAGACATGCAACTGTATAATGCTAA TTTTATATAAACACTTATCAATAAAGTGTATTACAGTTTAAAAAAAAAAA AAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 1039608..1040096 | 1..489 | 2430 | 99.8 | Plus |
chrX | 22417052 | chrX | 671749..672129 | 1..378 | 940 | 83.7 | Plus |
chrX | 22417052 | chrX | 21017528..21017893 | 375..10 | 585 | 77.3 | Minus |
chrX | 22417052 | chrX | 21028704..21029069 | 375..10 | 585 | 77.3 | Minus |
chrU | 10048995 | chrU | 5575462..5575827 | 375..10 | 585 | 77.3 | Minus |
chrX | 22417052 | chrX | 884587..884805 | 76..294 | 510 | 82.2 | Plus |
chrU | 10048995 | chrU | 8591052..8591222 | 10..180 | 450 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 1145644..1146134 | 1..491 | 2455 | 100 | Plus |
X | 23542271 | X | 777763..778143 | 1..378 | 940 | 83.7 | Plus |
X | 23542271 | X | 21152371..21152736 | 375..10 | 585 | 77.3 | Minus |
X | 23542271 | X | 21163547..21163912 | 375..10 | 585 | 77.3 | Minus |
X | 23542271 | X | 990605..990823 | 76..294 | 495 | 81.7 | Plus |
U | 3151297 | U | 3102315..3102485 | 10..180 | 450 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 1153742..1154232 | 1..491 | 2455 | 100 | Plus |
X | 23527363 | X | 785861..786200 | 1..340 | 920 | 84.7 | Plus |
X | 23527363 | X | 998703..998921 | 76..294 | 495 | 81.7 | Plus |
X | 23527363 | X | 21137655..21137828 | 183..10 | 465 | 84.4 | Minus |
X | 23527363 | X | 21148831..21149004 | 183..10 | 465 | 84.4 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 1039608..1040096 | 1..489 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..426 | 35..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..426 | 35..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..426 | 35..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..426 | 35..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..426 | 35..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..489 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..489 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..489 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..489 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14628-RA | 1..489 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 1145644..1146132 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 1145644..1146132 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 1145644..1146132 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 1039677..1040165 | 1..489 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 1153742..1154230 | 1..489 | 100 | Plus |
Translation from 34 to 459
> IP04504.pep MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLV TNNQGFIQFARESEAKLAIETLDHTTFKSKVILVSNASFRSLNASCLGYA PPGQMMIEWSDEDDVDEYDDYSESDDEDGPGDMQLYNANFI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23867-PA | 366 | GF23867-PA | 2..86 | 4..88 | 203 | 44.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12822-PA | 204 | GG12822-PA | 1..115 | 1..115 | 429 | 69.8 | Plus |
Dere\GG14412-PA | 371 | GG14412-PA | 1..104 | 1..104 | 227 | 45.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15151-PA | 375 | GH15151-PA | 11..94 | 8..91 | 188 | 42.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14628-PA | 141 | CG14628-PA | 1..141 | 1..141 | 729 | 100 | Plus |
fz3-PB | 646 | CG16785-PB | 1..137 | 1..129 | 439 | 68.6 | Plus |
CG18823-PA | 106 | CG18823-PA | 9..106 | 15..121 | 285 | 57 | Plus |
Neos-PB | 371 | CG8614-PB | 1..97 | 1..97 | 217 | 45.4 | Plus |
Neos-PA | 371 | CG8614-PA | 1..97 | 1..97 | 217 | 45.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12088-PA | 378 | GI12088-PA | 10..94 | 7..91 | 206 | 45.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL24901-PA | 374 | GL24901-PA | 16..88 | 18..90 | 197 | 50.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21209-PA | 374 | GA21209-PA | 16..89 | 18..91 | 198 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18998-PA | 141 | GM18998-PA | 1..141 | 1..141 | 508 | 83 | Plus |
Dsec\GM19114-PA | 141 | GM19114-PA | 1..141 | 1..141 | 508 | 83 | Plus |
Dsec\GM19098-PA | 186 | GM19098-PA | 1..115 | 1..115 | 372 | 64.3 | Plus |
Dsec\GM19104-PA | 117 | GM19104-PA | 1..116 | 1..125 | 360 | 59.2 | Plus |
Dsec\GM19027-PA | 184 | GM19027-PA | 1..115 | 1..115 | 353 | 61.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD16527-PA | 162 | GD16527-PA | 1..116 | 1..115 | 440 | 73.3 | Plus |
Dsim\GD16538-PA | 121 | GD16538-PA | 1..115 | 1..125 | 376 | 63.2 | Plus |
Dsim\GD16533-PA | 183 | GD16533-PA | 1..115 | 1..115 | 371 | 64.3 | Plus |
Dsim\GD16464-PA | 184 | GD16464-PA | 1..115 | 1..115 | 348 | 61.7 | Plus |
Dsim\GD16465-PA | 230 | GD16465-PA | 106..196 | 25..115 | 256 | 56 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13359-PA | 375 | GJ13359-PA | 11..99 | 8..94 | 203 | 44.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13148-PA | 371 | GK13148-PA | 10..93 | 7..90 | 194 | 42.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16653-PA | 111 | GE16653-PA | 1..110 | 1..115 | 371 | 63.5 | Plus |
Dyak\GE16652-PA | 105 | GE16652-PA | 1..103 | 1..103 | 365 | 67 | Plus |
Dyak\GE21602-PA | 371 | GE21602-PA | 1..104 | 1..104 | 228 | 45.2 | Plus |
Translation from 34 to 459
> IP04504.hyp MSASDIAGIELTSGPTGLKSRILVRNLPVCTRQELAYLCLPFGEILGSLV TNNQGFIQFARESEAKLAIETLDHTTFKSKVILVSNASFRSLNASCLGYA PPGQMMIEWSDEDDVDEYDDYSESDDEDGPGDMQLYNANFI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14628-PA | 141 | CG14628-PA | 1..141 | 1..141 | 729 | 100 | Plus |
fz3-PB | 646 | CG16785-PB | 1..137 | 1..129 | 439 | 68.6 | Plus |
CG18823-PA | 106 | CG18823-PA | 9..106 | 15..121 | 285 | 57 | Plus |
Neos-PB | 371 | CG8614-PB | 1..97 | 1..97 | 217 | 45.4 | Plus |
Neos-PA | 371 | CG8614-PA | 1..97 | 1..97 | 217 | 45.4 | Plus |