Clone IP04521 Report

Search the DGRC for IP04521

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:21
Vector:pOT2
Associated Gene/TranscriptCG15116-RA
Protein status:IP04521.pep: gold
Preliminary Size:483
Sequenced Size:662

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15116 2005-01-01 Successful iPCR screen
CG15116 2008-04-29 Release 5.5 accounting
CG15116 2008-08-15 Release 5.9 accounting
CG15116 2008-12-18 5.12 accounting

Clone Sequence Records

IP04521.complete Sequence

662 bp (662 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022334

> IP04521.complete
CACGCTAGACGATGTTCGATAAAGAATTTCTTTTCCCAGGCCTTTTGGTT
GCAGTGGCCTTGGTGGTAGTATTACAAACACGCAGCAGATTGCAACAGGA
TTTGCAGGATATGCGATGGCGTCTGACGATACACGCTCTCACCGTTCGAG
ATACGTTTGGGAATCCAGTGCAACTCGATACATTCGCCGGCCATGTGTTG
CTTATCGTCAACATTGCCTCCAAATGCGGACTTACTTTATCTCAGTACAA
CGGTTTGCGCTATTTACTCGAGGAATATGAAGACCAGGGCTTGAGAATTT
TAAACTTTCCCTGTAACCAGTTTGGGGGTCAAATGCCCGAGTCCGATGGC
CAGGAAATGTTGGATCACCTGCGCAGGGAGGGAGCCAACATAGGACACCT
CTTTGCCAAGATAGATGTAAAGGGAGCTCAGGCAGATCCGCTGTACAAGC
TCCTAACGCGCCACCAGCATGATATCGAATGGAATTTTGTCAAGTTTCTG
GTGGATCGAAAGGGAAACATCCACAAGAGATATGGCGCCGAACTGGAACC
AGTTGCCCTGACCGATGACATAGAGCTGCTGCTCGGCAGATGAGTCCGAA
TAAATAACGCAACATACGCGTTTCTGCCCACTGGCTTCCATAAAAAAAAA
AAAAAAAAAAAA

IP04521.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15116-RA 729 CG15116-RA 22..664 1..643 3215 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:47:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14942326..14942743 641..224 2090 100 Minus
chr2R 21145070 chr2R 14942797..14943019 223..1 1115 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:47:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19055229..19055648 643..224 2100 100 Minus
2R 25286936 2R 19055702..19055924 223..1 1115 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19056428..19056847 643..224 2100 100 Minus
2R 25260384 2R 19056901..19057123 223..1 1115 100 Minus
Blast to na_te.dros performed on 2019-03-15 14:47:17 has no hits.

IP04521.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:48:26 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14942326..14942743 224..641 100 <- Minus
chr2R 14942797..14943019 1..223 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:25 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..582 12..593 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:17 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..582 12..593 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:41:33 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..582 12..593 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:15 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..582 12..593 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:10 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..582 12..593 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:03 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:17 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:41:33 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:15 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..641 1..641 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:10 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
CG15116-RA 1..641 1..641 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:26 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19055231..19055648 224..641 100 <- Minus
2R 19055702..19055924 1..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:26 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19055231..19055648 224..641 100 <- Minus
2R 19055702..19055924 1..223 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:26 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19055231..19055648 224..641 100 <- Minus
2R 19055702..19055924 1..223 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:41:33 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14942736..14943153 224..641 100 <- Minus
arm_2R 14943207..14943429 1..223 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:35 Download gff for IP04521.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19056430..19056847 224..641 100 <- Minus
2R 19056901..19057123 1..223 100   Minus

IP04521.pep Sequence

Translation from 11 to 592

> IP04521.pep
MFDKEFLFPGLLVAVALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFG
NPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFP
CNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTR
HQHDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIELLLGR*

IP04521.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13732-PA 195 GF13732-PA 1..191 1..191 661 63.9 Plus
Dana\GF10532-PA 240 GF10532-PA 77..240 33..191 440 51.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20925-PA 193 GG20925-PA 1..193 1..193 950 91.7 Plus
Dere\GG15132-PA 265 GG15132-PA 102..265 33..191 426 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15953-PA 245 GH15953-PA 71..245 22..191 426 47.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15116-PA 193 CG15116-PA 1..193 1..193 1007 100 Plus
PHGPx-PA 169 CG12013-PA 6..169 33..191 403 50.6 Plus
PHGPx-PC 198 CG12013-PC 35..198 33..191 403 50.6 Plus
PHGPx-PD 238 CG12013-PD 75..238 33..191 403 50.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16605-PA 213 GI16605-PA 8..213 5..191 432 45.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10571-PA 201 GL10571-PA 1..197 1..192 607 60.4 Plus
Dper\GL16141-PA 238 GL16141-PA 75..238 33..191 415 48.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13504-PA 201 GA13504-PA 1..197 1..192 608 60.4 Plus
Dpse\GA11336-PA 238 GA11336-PA 75..238 33..191 415 48.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19853-PA 193 GM19853-PA 1..193 1..193 1003 97.9 Plus
Dsec\GM14565-PA 253 GM14565-PA 90..253 33..191 425 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25340-PA 193 GD25340-PA 1..193 1..193 994 96.9 Plus
Dsim\GD13757-PA 196 GD13757-PA 90..190 33..133 300 54.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12858-PA 244 GJ12858-PA 70..244 22..191 432 49.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:45:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19311-PA 194 GK19311-PA 2..190 3..191 478 54.7 Plus
Dwil\GK20508-PA 254 GK20508-PA 91..254 33..191 442 52.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13862-PA 193 GE13862-PA 1..193 1..193 946 91.2 Plus
Dyak\GE21358-PA 265 GE21358-PA 102..265 33..191 422 50 Plus

IP04521.hyp Sequence

Translation from 11 to 592

> IP04521.hyp
MFDKEFLFPGLLVAVALVVVLQTRSRLQQDLQDMRWRLTIHALTVRDTFG
NPVQLDTFAGHVLLIVNIASKCGLTLSQYNGLRYLLEEYEDQGLRILNFP
CNQFGGQMPESDGQEMLDHLRREGANIGHLFAKIDVKGAQADPLYKLLTR
HQHDIEWNFVKFLVDRKGNIHKRYGAELEPVALTDDIELLLGR*

IP04521.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG15116-PA 193 CG15116-PA 1..193 1..193 1007 100 Plus
PHGPx-PA 169 CG12013-PA 6..169 33..191 403 50.6 Plus
PHGPx-PC 198 CG12013-PC 35..198 33..191 403 50.6 Plus
PHGPx-PD 238 CG12013-PD 75..238 33..191 403 50.6 Plus