Clone IP04523 Report

Search the DGRC for IP04523

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:23
Vector:pOT2
Associated Gene/TranscriptCG15172-RA
Protein status:IP04523.pep: gold
Preliminary Size:487
Sequenced Size:526

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15172 2005-01-01 Successful iPCR screen
CG15172 2008-04-29 Release 5.5 accounting
CG15172 2008-08-15 Release 5.9 accounting
CG15172 2008-12-18 5.12 accounting

Clone Sequence Records

IP04523.complete Sequence

526 bp (526 high quality bases) assembled on 2006-06-12

GenBank Submission: BT025820

> IP04523.complete
GTTATCGACATTGGAAAAGGACTGACACCTTGAACACCATGTGTTTTAAT
GTACTGGGAGTGAGCAATCTGCTACCCGATTGCAGCATTGCAAACCGGGT
CCATCTGTTCTCTTTGCTGCAGCAACTCCAGAACCAGGAGCGTCGTCCGG
AGGAAGTGAGTGACGAGTTGCGGGATCGCTACAACGTATTTCGCCAGGTT
TTGCCCAACTACCCGCCACCGGAACAGCCAGACGACGATATGCTAGCAAA
CTTTGATGAGTTATTCCAGGAGCAGCTTTCAATATCGATCTTCACAGACA
CTGAATCATCCGGCGAGGAGACCTGCGAATCCAGTCTGGATAGTGACTCC
GAGCAGATCAGCATCGGGATGGATCGTCATCATTAGACCACATTCAATTA
AAAAGTGAAATTATGTCTTTCGTCTAATGTCTGCCAAGTGGTCGAGTAAA
TGAAAGTAAAACGTAGCCACTAATTGTTCGACAATAAAAAAGAGTAAATT
CAGCAAAAAAAAAAAAAAAAAAAAAA

IP04523.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG15172.a 580 CG15172.a 71..580 1..510 2535 99.8 Plus
CG15172.b 637 CG15172.b 128..637 1..510 2535 99.8 Plus
CG15172.c 718 CG15172.c 71..580 1..510 2535 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19021788..19022284 1..504 2365 98.4 Plus
chr2L 23010047 chr2L 19073862..19073977 215..100 460 93.1 Minus
chr2L 23010047 chr2L 19073759..19073852 341..248 365 92.6 Minus
chr2L 23010047 chr2L 19073632..19073723 446..355 340 91.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 17:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
CR33315-RA 421 CR33315-RA 38..153 100..215 460 93.1 Plus
CR33315-RA 421 CR33315-RA 163..256 248..341 365 92.5 Plus
CR33315-RA 421 CR33315-RA 292..383 355..446 340 91.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19023141..19023650 1..510 2535 99.8 Plus
2L 23513712 2L 19075260..19075375 215..100 460 93.1 Minus
2L 23513712 2L 19075157..19075250 341..248 365 92.6 Minus
2L 23513712 2L 19074956..19075121 510..355 345 83.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19023141..19023650 1..510 2535 99.8 Plus
2L 23513712 2L 19075260..19075375 215..100 460 93.1 Minus
2L 23513712 2L 19075157..19075250 341..248 365 92.5 Minus
2L 23513712 2L 19075030..19075121 446..355 340 91.3 Minus
2L 23513712 2L 19074956..19075016 510..449 180 88.7 Minus
2L 23513712 2L 19075413..19075440 28..1 140 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:56:38 has no hits.

IP04523.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:57:17 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19021788..19022284 1..504 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:25 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RA 1..348 39..386 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:15 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RA 1..348 39..386 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:04 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RB 1..348 39..386 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:58 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RA 1..348 39..386 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:10 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RB 1..348 39..386 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:42 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:13 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RA 1..481 24..504 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:15 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RA 1..481 24..504 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:04 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RB 128..631 1..504 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:58 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RA 1..481 24..504 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:10 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
CG15172-RB 128..631 1..504 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:17 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19023141..19023644 1..504 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:17 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19023141..19023644 1..504 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:17 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19023141..19023644 1..504 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:04 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19023141..19023644 1..504 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:04 Download gff for IP04523.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19023141..19023644 1..504 100   Plus

IP04523.hyp Sequence

Translation from 2 to 385

> IP04523.hyp
YRHWKRTDTLNTMCFNVLGVSNLLPDCSIANRVHLFSLLQQLQNQERRPE
EVSDELRDRYNVFRQVLPNYPPPEQPDDDMLANFDELFQEQLSISIFTDT
ESSGEETCESSLDSDSEQISIGMDRHH*

IP04523.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15172-PD 115 CG15172-PD 1..115 13..127 602 100 Plus
CG15172-PC 115 CG15172-PC 1..115 13..127 602 100 Plus
CG15172-PB 115 CG15172-PB 1..115 13..127 602 100 Plus
CG15172-PA 115 CG15172-PA 1..115 13..127 602 100 Plus

IP04523.pep Sequence

Translation from 38 to 385

> IP04523.pep
MCFNVLGVSNLLPDCSIANRVHLFSLLQQLQNQERRPEEVSDELRDRYNV
FRQVLPNYPPPEQPDDDMLANFDELFQEQLSISIFTDTESSGEETCESSL
DSDSEQISIGMDRHH*

IP04523.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19701-PA 121 GF19701-PA 1..83 1..84 228 59.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:34:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21655-PA 115 GG21655-PA 1..87 1..87 320 72.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10644-PA 132 GH10644-PA 9..59 11..61 148 52.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15172-PD 115 CG15172-PD 1..115 1..115 602 100 Plus
CG15172-PC 115 CG15172-PC 1..115 1..115 602 100 Plus
CG15172-PB 115 CG15172-PB 1..115 1..115 602 100 Plus
CG15172-PA 115 CG15172-PA 1..115 1..115 602 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10791-PA 168 GI10791-PA 1..61 1..61 184 59 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17311-PA 115 GM17311-PA 1..115 1..115 498 84.3 Plus
Dsec\GM17032-PA 92 GM17032-PA 1..88 1..88 395 86.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24171-PA 115 GD24171-PA 1..115 1..115 487 82.6 Plus
Dsim\GD21782-PA 92 GD21782-PA 1..87 1..87 378 83.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:34:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18282-PA 166 GJ18282-PA 1..61 1..61 178 59 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24392-PA 152 GK24392-PA 1..68 1..66 157 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12674-PA 108 GE12674-PA 1..87 1..87 317 71.3 Plus