IP04523.complete Sequence
526 bp (526 high quality bases) assembled on 2006-06-12
GenBank Submission: BT025820
> IP04523.complete
GTTATCGACATTGGAAAAGGACTGACACCTTGAACACCATGTGTTTTAAT
GTACTGGGAGTGAGCAATCTGCTACCCGATTGCAGCATTGCAAACCGGGT
CCATCTGTTCTCTTTGCTGCAGCAACTCCAGAACCAGGAGCGTCGTCCGG
AGGAAGTGAGTGACGAGTTGCGGGATCGCTACAACGTATTTCGCCAGGTT
TTGCCCAACTACCCGCCACCGGAACAGCCAGACGACGATATGCTAGCAAA
CTTTGATGAGTTATTCCAGGAGCAGCTTTCAATATCGATCTTCACAGACA
CTGAATCATCCGGCGAGGAGACCTGCGAATCCAGTCTGGATAGTGACTCC
GAGCAGATCAGCATCGGGATGGATCGTCATCATTAGACCACATTCAATTA
AAAAGTGAAATTATGTCTTTCGTCTAATGTCTGCCAAGTGGTCGAGTAAA
TGAAAGTAAAACGTAGCCACTAATTGTTCGACAATAAAAAAGAGTAAATT
CAGCAAAAAAAAAAAAAAAAAAAAAA
IP04523.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:49:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15172.a | 580 | CG15172.a | 71..580 | 1..510 | 2535 | 99.8 | Plus |
CG15172.b | 637 | CG15172.b | 128..637 | 1..510 | 2535 | 99.8 | Plus |
CG15172.c | 718 | CG15172.c | 71..580 | 1..510 | 2535 | 99.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:56:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 19021788..19022284 | 1..504 | 2365 | 98.4 | Plus |
chr2L | 23010047 | chr2L | 19073862..19073977 | 215..100 | 460 | 93.1 | Minus |
chr2L | 23010047 | chr2L | 19073759..19073852 | 341..248 | 365 | 92.6 | Minus |
chr2L | 23010047 | chr2L | 19073632..19073723 | 446..355 | 340 | 91.3 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 17:42:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CR33315-RA | 421 | CR33315-RA | 38..153 | 100..215 | 460 | 93.1 | Plus |
CR33315-RA | 421 | CR33315-RA | 163..256 | 248..341 | 365 | 92.5 | Plus |
CR33315-RA | 421 | CR33315-RA | 292..383 | 355..446 | 340 | 91.3 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:56:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19023141..19023650 | 1..510 | 2535 | 99.8 | Plus |
2L | 23513712 | 2L | 19075260..19075375 | 215..100 | 460 | 93.1 | Minus |
2L | 23513712 | 2L | 19075157..19075250 | 341..248 | 365 | 92.6 | Minus |
2L | 23513712 | 2L | 19074956..19075121 | 510..355 | 345 | 83.2 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 19023141..19023650 | 1..510 | 2535 | 99.8 | Plus |
2L | 23513712 | 2L | 19075260..19075375 | 215..100 | 460 | 93.1 | Minus |
2L | 23513712 | 2L | 19075157..19075250 | 341..248 | 365 | 92.5 | Minus |
2L | 23513712 | 2L | 19075030..19075121 | 446..355 | 340 | 91.3 | Minus |
2L | 23513712 | 2L | 19074956..19075016 | 510..449 | 180 | 88.7 | Minus |
2L | 23513712 | 2L | 19075413..19075440 | 28..1 | 140 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 18:56:38 has no hits.
IP04523.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:57:17 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 19021788..19022284 | 1..504 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:25 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RA | 1..348 | 39..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:15 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RA | 1..348 | 39..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:04 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RB | 1..348 | 39..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:24:58 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RA | 1..348 | 39..386 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:10 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RB | 1..348 | 39..386 | 100 | | Plus |
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:42 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:13 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RA | 1..481 | 24..504 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:15 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RA | 1..481 | 24..504 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:04 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RB | 128..631 | 1..504 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:24:58 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RA | 1..481 | 24..504 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:10 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15172-RB | 128..631 | 1..504 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:17 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19023141..19023644 | 1..504 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:17 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19023141..19023644 | 1..504 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:17 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19023141..19023644 | 1..504 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:04 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 19023141..19023644 | 1..504 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:04 Download gff for
IP04523.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 19023141..19023644 | 1..504 | 100 | | Plus |
IP04523.hyp Sequence
Translation from 2 to 385
> IP04523.hyp
YRHWKRTDTLNTMCFNVLGVSNLLPDCSIANRVHLFSLLQQLQNQERRPE
EVSDELRDRYNVFRQVLPNYPPPEQPDDDMLANFDELFQEQLSISIFTDT
ESSGEETCESSLDSDSEQISIGMDRHH*
IP04523.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:27:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15172-PD | 115 | CG15172-PD | 1..115 | 13..127 | 602 | 100 | Plus |
CG15172-PC | 115 | CG15172-PC | 1..115 | 13..127 | 602 | 100 | Plus |
CG15172-PB | 115 | CG15172-PB | 1..115 | 13..127 | 602 | 100 | Plus |
CG15172-PA | 115 | CG15172-PA | 1..115 | 13..127 | 602 | 100 | Plus |
IP04523.pep Sequence
Translation from 38 to 385
> IP04523.pep
MCFNVLGVSNLLPDCSIANRVHLFSLLQQLQNQERRPEEVSDELRDRYNV
FRQVLPNYPPPEQPDDDMLANFDELFQEQLSISIFTDTESSGEETCESSL
DSDSEQISIGMDRHH*
IP04523.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:34:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF19701-PA | 121 | GF19701-PA | 1..83 | 1..84 | 228 | 59.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:34:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG21655-PA | 115 | GG21655-PA | 1..87 | 1..87 | 320 | 72.4 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:34:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH10644-PA | 132 | GH10644-PA | 9..59 | 11..61 | 148 | 52.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15172-PD | 115 | CG15172-PD | 1..115 | 1..115 | 602 | 100 | Plus |
CG15172-PC | 115 | CG15172-PC | 1..115 | 1..115 | 602 | 100 | Plus |
CG15172-PB | 115 | CG15172-PB | 1..115 | 1..115 | 602 | 100 | Plus |
CG15172-PA | 115 | CG15172-PA | 1..115 | 1..115 | 602 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:34:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI10791-PA | 168 | GI10791-PA | 1..61 | 1..61 | 184 | 59 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:34:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17311-PA | 115 | GM17311-PA | 1..115 | 1..115 | 498 | 84.3 | Plus |
Dsec\GM17032-PA | 92 | GM17032-PA | 1..88 | 1..88 | 395 | 86.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:34:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24171-PA | 115 | GD24171-PA | 1..115 | 1..115 | 487 | 82.6 | Plus |
Dsim\GD21782-PA | 92 | GD21782-PA | 1..87 | 1..87 | 378 | 83.9 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:34:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ18282-PA | 166 | GJ18282-PA | 1..61 | 1..61 | 178 | 59 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:34:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK24392-PA | 152 | GK24392-PA | 1..68 | 1..66 | 157 | 50 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:34:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12674-PA | 108 | GE12674-PA | 1..87 | 1..87 | 317 | 71.3 | Plus |