Clone IP04527 Report

Search the DGRC for IP04527

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:27
Vector:pOT2
Associated Gene/TranscriptCG15278-RA
Protein status:IP04527.pep: gold
Preliminary Size:474
Sequenced Size:921

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15278 2005-01-01 Successful iPCR screen
CG15278 2008-04-29 Release 5.5 accounting
CG15278 2008-08-15 Release 5.9 accounting
CG15278 2008-12-18 5.12 accounting

Clone Sequence Records

IP04527.complete Sequence

921 bp (935 high quality bases) assembled on 2010-02-25

GenBank Submission: BT029042.2

> IP04527.complete
TTTATACATTTGTAAGGCGGAGTCAGTTATAATGGCCGATTTCCATGAAC
TTATTGTGACTTGCATTATTTTCCTATACCAAATTATTTTGATTTTCCGA
TCAATCCACCCCTTCAGAAAAGACGCTATGCTGCTTATTTTGCACAACGT
TCTGCTGTACTACGTGATCAATATGTTCAAGCATTTGGCCCAGGCATCGA
TTAACTCGGACGGACCGGTGAACACATTCTACTACGTACCATTGGTGTAT
GAAGAAAACATTGCCTTGGGACGCCATCAGAGTTGGCATGAGGTCCTTAG
GACATCCAGCTGGCAATTCTTTGAGGTCCTTTTCAGACATCATCTGGCCC
TGCTGTTGCCATTTAATTTGGCTCTCCTGGTGCCCCGCTGCAAGTTGGCC
TTCATTAGCACACTGGTTCTCTTGTCGAACTTTGTGCTGTTCGTCTGTTT
CGCCTCGGCCATTTGTCAGCTGTTGTGGGTCCATGGCCACGCCCACAGCC
TGCGCCTCCTCACAATCATGTGTTTGGGCCCCGTTTGCCAAGTGGTTCTG
GTGTGCCGCCTCCTGGGCCGCGTGTGGCTCAGTCAGTGGATTCTTGTTTG
AGGCATGAAATTTGATTTGCCGGCACTGATTGCTGGCCAAAAGCCACACC
CCATCCATCGTAATCAGCACCACAGAAGTTTAGCAACAGCAACAGCAACA
GCAGCAGTAGCAGGAGCAGCGGCAAATCAAAGCAATAAACCAACTGAACC
CATCCGAAAATCACTTTCACTACACAAACTGCCAAACTGCAGGCATTTAT
GACAGCCAGGCGACGGAGGCGGTGCTGAGGGGGCCAAAATCGCATAACAA
AATTGTTGATGAAAAGTTGAACAAATATTGAGGTCAGCAGAATGTCGAGT
AAAAAAAAAAAAAAAAAAAAA

IP04527.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:35:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG15278.c 1239 CG15278.c 133..1033 1..901 4505 100 Plus
CG15278.d 1782 CG15278.d 133..710 1..578 2890 100 Plus
CG15278.a 1253 CG15278.a 133..710 1..578 2890 100 Plus
CG15278.d 1782 CG15278.d 723..1047 577..901 1625 100 Plus
CG15278.a 1253 CG15278.a 723..1047 577..901 1625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:08:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 14873883..14874206 900..577 1605 99.7 Minus
chr2L 23010047 chr2L 14874526..14874717 385..194 960 100 Minus
chr2L 23010047 chr2L 14874275..14874466 577..386 930 99 Minus
chr2L 23010047 chr2L 14874771..14874867 194..98 485 100 Minus
chr2L 23010047 chr2L 14874925..14875021 97..1 470 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14875113..14875437 901..577 1625 100 Minus
2L 23513712 2L 14875506..14875697 577..386 960 100 Minus
2L 23513712 2L 14875757..14875948 385..194 960 100 Minus
2L 23513712 2L 14876002..14876098 194..98 485 100 Minus
2L 23513712 2L 14876156..14876252 97..1 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 14875113..14875437 901..577 1625 100 Minus
2L 23513712 2L 14875757..14875948 385..194 960 100 Minus
2L 23513712 2L 14875506..14875697 577..386 960 100 Minus
2L 23513712 2L 14876156..14876252 97..1 485 100 Minus
2L 23513712 2L 14876002..14876098 194..98 485 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:08:02 has no hits.

IP04527.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:08:47 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 14874925..14875021 1..97 98   Minus
chr2L 14874275..14874466 386..577 98 <- Minus
chr2L 14874526..14874716 195..385 100 <- Minus
chr2L 14874771..14874867 98..194 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-02-25 16:47:50 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:54:45 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:12:40 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 15:49:24 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:56:53 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 1..474 128..601 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-02-25 16:47:45 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 1..773 128..900 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:54:45 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 1..884 17..900 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:12:40 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 1..900 1..900 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:49:24 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 135..451 264..578 99 == Plus
CG15278-RA 452..773 593..914 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:56:53 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
CG15278-RA 82..981 1..900 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:47 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14875114..14875436 578..900 100 <- Minus
2L 14875506..14875697 386..577 100 <- Minus
2L 14875757..14875947 195..385 100 <- Minus
2L 14876002..14876098 98..194 100 <- Minus
2L 14876156..14876252 1..97 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:47 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14875114..14875436 578..900 100 <- Minus
2L 14875506..14875697 386..577 100 <- Minus
2L 14875757..14875947 195..385 100 <- Minus
2L 14876002..14876098 98..194 100 <- Minus
2L 14876156..14876252 1..97 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:08:47 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14875114..14875436 578..900 100 <- Minus
2L 14875506..14875697 386..577 100 <- Minus
2L 14875757..14875947 195..385 100 <- Minus
2L 14876002..14876098 98..194 100 <- Minus
2L 14876156..14876252 1..97 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:12:40 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 14875757..14875947 195..385 100 <- Minus
arm_2L 14876002..14876098 98..194 100 <- Minus
arm_2L 14876156..14876252 1..97 100   Minus
arm_2L 14875114..14875436 578..900 100 <- Minus
arm_2L 14875506..14875697 386..577 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:31:13 Download gff for IP04527.complete
Subject Subject Range Query Range Percent Splice Strand
2L 14875114..14875436 578..900 100 <- Minus
2L 14875506..14875697 386..577 100 <- Minus
2L 14875757..14875947 195..385 100 <- Minus
2L 14876002..14876098 98..194 100 <- Minus
2L 14876156..14876252 1..97 100   Minus

IP04527.hyp Sequence

Translation from 0 to 600

> IP04527.hyp
LYICKAESVIMADFHELIVTCIIFLYQIILIFRSIHPFRKDAMLLILHNV
LLYYVINMFKHLAQASINSDGPVNTFYYVPLVYEENIALGRHQSWHEVLR
TSSWQFFEVLFRHHLALLLPFNLALLVPRCKLAFISTLVLLSNFVLFVCF
ASAICQLLWVHGHAHSLRLLTIMCLGPVCQVVLVCRLLGRVWLSQWILV*

IP04527.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15278-PA 157 CG15278-PA 1..157 43..199 831 100 Plus
CG15278-PC 160 CG15278-PC 1..150 43..192 795 100 Plus
CG15278-PB 164 CG15278-PB 1..150 43..192 795 100 Plus

IP04527.pep Sequence

Translation from 1 to 600

> IP04527.pep
LYICKAESVIMADFHELIVTCIIFLYQIILIFRSIHPFRKDAMLLILHNV
LLYYVINMFKHLAQASINSDGPVNTFYYVPLVYEENIALGRHQSWHEVLR
TSSWQFFEVLFRHHLALLLPFNLALLVPRCKLAFISTLVLLSNFVLFVCF
ASAICQLLWVHGHAHSLRLLTIMCLGPVCQVVLVCRLLGRVWLSQWILV*

IP04527.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15002-PA 331 GF15002-PA 165..331 33..199 612 72.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24236-PA 157 GG24236-PA 1..152 43..194 639 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10828-PA 277 GH10828-PA 111..277 33..199 443 52.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG15278-PA 157 CG15278-PA 1..157 43..199 831 100 Plus
CG15278-PC 160 CG15278-PC 1..150 43..192 795 100 Plus
CG15278-PB 164 CG15278-PB 1..150 43..192 795 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17339-PA 212 GI17339-PA 1..184 11..194 459 56 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25739-PA 351 GL25739-PA 1..184 11..193 490 60.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13622-PA 167 GA13622-PA 2..156 42..195 426 63.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14643-PA 157 GM14643-PA 1..157 43..199 788 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21982-PA 157 GD21982-PA 1..157 43..199 789 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16078-PA 189 GJ16078-PA 1..189 11..199 487 56.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24798-PA 157 GE24798-PA 1..157 43..199 698 94.3 Plus