Clone IP04530 Report

Search the DGRC for IP04530

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:30
Vector:pOT2
Associated Gene/TranscriptCG15362-RA
Protein status:IP04530.pep: validated not full length
Preliminary Size:507
Sequenced Size:692

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15362 2005-01-01 Successful iPCR screen
CG15362 2008-04-29 Release 5.5 accounting
CG15362 2008-08-15 Release 5.9 accounting
CG15362 2008-12-18 5.12 accounting

Clone Sequence Records

IP04530.complete Sequence

692 bp (692 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024403

> IP04530.complete
CATAGCCGGGCTGGCCGGTTTGGGCTTAATAGTTTTGGTATCGATCTACA
AATGTGCCAGTGGCGAGGTTCGCCAGGCGGAAAGCGAAAAGTGCTTCTTC
TGCGACTTCGCCCACCGCCGCCAAGGACCGCCGCCCATCCTGGAGGTGGA
GACGGACGAGTACGTGATCTTCAAGGACAAGTATCCGGCAGCCAGACTCC
ACTATCTGGCGATTCCCAAGGAGCACTTCGACAGCCTGAAAGCGCTGAAC
AAATCGCACGTTGGATTGGTGCGGCGAATGGAGCAGGGCATGATGGAATT
CCTGCGATCGCAGAACGTGGATCCCAAGGAGGCGATTGTGGGCTTCCACT
TGCCGCCGTTCATCTCGGTTCGCCACCTCCACCTGCACGGCATTTTCCCG
CCTGCCGACATGAGTTTCGGCAACAAGATCAGCTTTATGCCCTCATTCTG
GTTCAAAAAGTCCAGTGATGCGATTCGGGAATTGGAGGACCGGGAACTGT
GATATGGGCTTAGTTGCGGGAGAGGTGCAATTTAAAATTAAGAGTTTTTT
CATTACTGTCTTAAGTTTCAACCATCTGTGTCAACCCAGTGAGATTCAAG
CCCGTCAAAATGTACAAAGAAATGTAACTGATATATACAATTTAATATAA
ATTAGGGCTTACCCTATTAACTGCAAAAAAAAAAAAAAAAAA

IP04530.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG15362-RA 866 CG15362-RA 190..864 1..675 3375 100 Plus
CG15362.a 866 CG15362.a 190..864 1..675 3375 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1981065..1981333 1..269 1300 98.9 Plus
chr2L 23010047 chr2L 1981634..1981849 459..674 1080 100 Plus
chr2L 23010047 chr2L 1981391..1981582 269..460 945 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1981315..1981583 1..269 1345 100 Plus
2L 23513712 2L 1981884..1982100 459..675 1085 100 Plus
2L 23513712 2L 1981641..1981832 269..460 960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1981315..1981583 1..269 1345 100 Plus
2L 23513712 2L 1981884..1982100 459..675 1085 100 Plus
2L 23513712 2L 1981641..1981832 269..460 960 100 Plus
Blast to na_te.dros performed on 2019-03-15 14:47:25 has no hits.

IP04530.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:48:30 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1981636..1981849 461..674 100   Plus
chr2L 1981065..1981333 1..269 98 -> Plus
chr2L 1981392..1981582 270..460 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:28 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:37:55 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:41:44 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:12:55 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:08:19 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:09:46 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:37:55 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:41:44 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 140..813 1..674 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:12:55 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 6..507 1..502 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:08:19 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
CG15362-RA 140..813 1..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:30 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1981315..1981583 1..269 100 -> Plus
2L 1981642..1981832 270..460 100 -> Plus
2L 1981886..1982099 461..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:30 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1981315..1981583 1..269 100 -> Plus
2L 1981642..1981832 270..460 100 -> Plus
2L 1981886..1982099 461..674 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:48:30 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1981315..1981583 1..269 100 -> Plus
2L 1981642..1981832 270..460 100 -> Plus
2L 1981886..1982099 461..674 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:41:44 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1981315..1981583 1..269 100 -> Plus
arm_2L 1981642..1981832 270..460 100 -> Plus
arm_2L 1981886..1982099 461..674 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:01:00 Download gff for IP04530.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1981886..1982099 461..674 100   Plus
2L 1981315..1981583 1..269 100 -> Plus
2L 1981642..1981832 270..460 100 -> Plus

IP04530.hyp Sequence

Translation from 0 to 501

> IP04530.hyp
IAGLAGLGLIVLVSIYKCASGEVRQAESEKCFFCDFAHRRQGPPPILEVE
TDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRMEQGMMEF
LRSQNVDPKEAIVGFHLPPFISVRHLHLHGIFPPADMSFGNKISFMPSFW
FKKSSDAIRELEDREL*

IP04530.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:28:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15362-PA 168 CG15362-PA 3..168 1..166 875 100 Plus
CG34015-PA 139 CG34015-PA 4..139 29..165 330 47.4 Plus

IP04530.pep Sequence

Translation from 1 to 501

> IP04530.pep
IAGLAGLGLIVLVSIYKCASGEVRQAESEKCFFCDFAHRRQGPPPILEVE
TDEYVIFKDKYPAARLHYLAIPKEHFDSLKALNKSHVGLVRRMEQGMMEF
LRSQNVDPKEAIVGFHLPPFISVRHLHLHGIFPPADMSFGNKISFMPSFW
FKKSSDAIRELEDREL*

IP04530.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15313-PA 174 GF15313-PA 24..174 16..166 618 71.5 Plus
Dana\GF10237-PA 140 GF10237-PA 4..139 29..165 368 50.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24817-PA 168 GG24817-PA 3..168 1..166 790 88 Plus
Dere\GG19320-PA 139 GG19320-PA 4..139 29..165 361 49.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:22:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25016-PA 174 GH25016-PA 22..173 16..166 445 53.6 Plus
Dgri\GH10860-PA 162 GH10860-PA 22..162 16..155 419 54.9 Plus
Dgri\GH17587-PA 140 GH17587-PA 4..138 29..164 339 44.5 Plus
Dgri\GH17102-PA 145 GH17102-PA 4..126 29..152 314 45.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15362-PA 168 CG15362-PA 3..168 1..166 875 100 Plus
CG34015-PA 139 CG34015-PA 4..139 29..165 330 47.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:22:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13693-PA 163 GI13693-PA 11..162 4..155 435 54.9 Plus
Dmoj\GI11708-PA 140 GI11708-PA 2..138 27..164 345 46 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20536-PA 152 GL20536-PA 9..152 23..166 561 68.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13672-PA 181 GA13672-PA 30..181 16..166 566 65.8 Plus
Dpse\GA25735-PA 140 GA25735-PA 3..139 28..165 373 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:22:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16839-PA 168 GM16839-PA 3..168 1..166 841 95.2 Plus
Dsec\GM10095-PA 168 GM10095-PA 3..168 1..166 841 95.2 Plus
Dsec\GM13398-PA 139 GM13398-PA 3..139 28..165 327 46.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23121-PA 168 GD23121-PA 3..168 1..166 841 95.2 Plus
Dsim\GD15748-PA 139 GD15748-PA 4..139 29..165 330 47.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11382-PA 140 GJ11382-PA 4..140 29..166 355 47.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:22:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24814-PA 161 GK24814-PA 2..161 9..166 526 62.5 Plus
Dwil\GK10717-PA 140 GK10717-PA 2..131 28..157 368 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17812-PA 168 GE17812-PA 3..168 1..166 813 90.4 Plus
Dyak\GE15967-PA 139 GE15967-PA 4..139 29..165 352 47.4 Plus