Clone IP04548 Report

Search the DGRC for IP04548

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:48
Vector:pOT2
Associated Gene/TranscriptCG15876-RA
Protein status:IP04548.pep: gold
Preliminary Size:491
Sequenced Size:636

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15876 2005-01-01 Successful iPCR screen
CG15876 2008-04-29 Release 5.5 accounting
CG15876 2008-08-15 Release 5.9 accounting
CG15876 2008-12-18 5.12 accounting

Clone Sequence Records

IP04548.complete Sequence

636 bp (636 high quality bases) assembled on 2006-06-06

GenBank Submission: BT025906

> IP04548.complete
CCAAGCAGTCACAGCTTGTCCTGTCGCAGCCAGCATTTTGAAGTCTATAC
AAAAAAAAACAACAAAGGAGCTATTCTATCTGAAATGGAAGCCCAACGTA
ACAACGCCAACCACCGACGCGGAGCTCGTCCGAGCGTGGGCTATCTACTT
TTTCAGTACCAGAGCGAGCTGACCCGCCGTCATGCGGAACCCACGCGGCT
GTCCCGCACCAAGATTCACATAATCGATGGACTGGTGTCCCGCACCATCC
GCCACATGAAGCACTGCAGCATGGAGGATCTGAGGGCCTGCAAGAGGGAG
CTCGTCTACAAGGAGCAGCTGCGCGATCAGCTCAAGAACATGCGACGCAA
ACGCTCCTCCTCCGTCAACAAAGTCGATGCTAGTGCCAACACATCCGCCC
CCGTTGTGAGTGTCAAGGCGCCCTGCACTCCACCGAAACCTCGATCCTCC
ACAGGAGAGTTCTCCAAGATGGACATCTTCGGACCGGAGATCTTCGTTTA
AGTTTAACTTAATCTATTGCAATTTTAAATTTACTAGTTTCCTTAATTGT
TGACGATTAAAAATCATTGAACATGAAGATTTCTTAAGAAAATTATTCAA
TAAATAAATATATAAAAGCAAAAAAAAAAAAAAAAA

IP04548.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15876-RA 619 CG15876-RA 1..619 1..619 3080 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:02:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4693559..4694177 619..1 3020 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4694201..4694823 623..1 3100 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4694201..4694823 623..1 3100 99.8 Minus
Blast to na_te.dros performed 2019-03-16 17:02:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4058..4174 497..616 159 62.5 Plus
Tabor 7345 Tabor TABOR 7345bp 1152..1207 559..617 116 71.2 Plus
accord2 7650 accord2 QBERT 7650bp 7023..7079 617..561 114 66.7 Minus
Tirant 8526 Tirant TIRANT 8526bp 612..643 586..617 106 81.2 Plus

IP04548.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:03:26 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4693591..4694177 1..587 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:32 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..417 85..501 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:23:08 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..417 85..501 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:51:01 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..417 85..501 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:41:43 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..417 85..501 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:49:56 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..417 85..501 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:51:19 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..619 1..619 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:23:07 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..619 1..619 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:51:01 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 23..641 1..619 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:41:43 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 1..619 1..619 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:49:56 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15876-RA 23..641 1..619 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:26 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4694205..4694823 1..619 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:26 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4694205..4694823 1..619 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:03:26 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4694205..4694823 1..619 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:51:01 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4694205..4694823 1..619 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:11 Download gff for IP04548.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4694205..4694823 1..619 99   Minus

IP04548.hyp Sequence

Translation from 0 to 500

> IP04548.hyp
PSSHSLSCRSQHFEVYTKKNNKGAILSEMEAQRNNANHRRGARPSVGYLL
FQYQSELTRRHAEPTRLSRTKIHIIDGLVSRTIRHMKHCSMEDLRACKRE
LVYKEQLRDQLKNMRRKRSSSVNKVDASANTSAPVVSVKAPCTPPKPRSS
TGEFSKMDIFGPEIFV*

IP04548.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:28:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15876-PA 138 CG15876-PA 1..138 29..166 712 100 Plus
CG13713-PA 99 CG13713-PA 8..82 43..117 194 48 Plus
CG13711-PA 127 CG13711-PA 21..119 28..126 160 29.3 Plus
CG13716-PA 117 CG13716-PA 11..94 28..111 136 31 Plus

IP04548.pep Sequence

Translation from 84 to 500

> IP04548.pep
MEAQRNNANHRRGARPSVGYLLFQYQSELTRRHAEPTRLSRTKIHIIDGL
VSRTIRHMKHCSMEDLRACKRELVYKEQLRDQLKNMRRKRSSSVNKVDAS
ANTSAPVVSVKAPCTPPKPRSSTGEFSKMDIFGPEIFV*

IP04548.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24716-PA 138 GF24716-PA 1..138 1..138 515 72.1 Plus
Dana\GF25088-PA 102 GF25088-PA 3..81 10..88 209 48.1 Plus
Dana\GF25089-PA 124 GF25089-PA 34..112 16..94 173 36.7 Plus
Dana\GF24722-PA 122 GF24722-PA 32..99 16..83 134 38.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:22:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14164-PA 137 GG14164-PA 1..137 1..138 637 87.7 Plus
Dere\GG15244-PA 99 GG15244-PA 8..82 15..89 198 49.3 Plus
Dere\GG15245-PA 126 GG15245-PA 36..114 16..94 163 34.2 Plus
Dere\GG14170-PA 120 GG14170-PA 30..97 16..83 132 36.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24970-PA 142 GH24970-PA 1..142 1..138 446 66 Plus
Dgri\GH15792-PA 142 GH15792-PA 1..142 1..138 445 66 Plus
Dgri\GH15694-PA 88 GH15694-PA 2..82 9..89 203 46.9 Plus
Dgri\GH15695-PA 111 GH15695-PA 21..99 16..94 161 35.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15876-PA 138 CG15876-PA 1..138 1..138 712 100 Plus
CG13713-PA 99 CG13713-PA 8..82 15..89 194 48 Plus
CG13711-PA 127 CG13711-PA 23..119 2..98 158 29.9 Plus
CG13716-PA 117 CG13716-PA 12..94 1..83 135 31.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:22:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12575-PA 144 GI12575-PA 1..144 1..138 456 69.9 Plus
Dmoj\GI12748-PA 116 GI12748-PA 26..98 16..88 160 37 Plus
Dmoj\GI12746-PA 86 GI12746-PA 5..81 12..88 157 46.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17934-PA 224 GL17934-PA 83..224 1..138 462 66.2 Plus
Dper\GL17913-PA 103 GL17913-PA 2..79 9..86 211 52.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13997-PA 139 GA13997-PA 1..139 1..138 466 66.2 Plus
Dpse\GA12478-PA 100 GA12478-PA 2..79 9..86 211 52.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13954-PA 138 GM13954-PA 1..138 1..138 701 94.2 Plus
Dsec\GM14677-PA 99 GM14677-PA 8..82 15..89 198 49.3 Plus
Dsec\GM14678-PA 126 GM14678-PA 36..118 16..98 162 32.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13237-PA 138 GD13237-PA 1..138 1..138 701 94.2 Plus
Dsim\GD13859-PA 99 GD13859-PA 8..82 15..89 195 48 Plus
Dsim\GD13861-PA 146 GD13861-PA 36..130 16..110 169 31.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15479-PA 144 GJ15479-PA 1..144 1..138 475 67.3 Plus
Dvir\GJ15515-PA 90 GJ15515-PA 3..82 10..89 209 50 Plus
Dvir\GJ15516-PA 115 GJ15516-PA 25..103 16..94 162 38 Plus
Dvir\GJ10727-PA 108 GJ10727-PA 17..96 16..95 132 32.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17596-PA 143 GK17596-PA 1..143 1..138 471 69.2 Plus
Dwil\GK16597-PA 97 GK16597-PA 6..77 12..83 212 52.8 Plus
Dwil\GK16598-PA 121 GK16598-PA 31..109 16..94 147 32.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:22:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20591-PA 138 GE20591-PA 1..138 1..138 679 92.8 Plus
Dyak\GE21466-PA 99 GE21466-PA 3..82 10..89 204 47.5 Plus
Dyak\GE21467-PA 120 GE21467-PA 30..112 16..98 167 33.7 Plus
Dyak\GE20598-PA 120 GE20598-PA 30..97 16..83 137 38.2 Plus