Clone IP04554 Report

Search the DGRC for IP04554

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:54
Vector:pOT2
Associated Gene/TranscriptCG16986-RA
Protein status:IP04554.pep: gold
Preliminary Size:432
Sequenced Size:664

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16986 2005-01-01 Successful iPCR screen
CG16986 2008-04-29 Release 5.5 accounting
CG16986 2008-08-15 Release 5.9 accounting
CG16986 2008-12-18 5.12 accounting

Clone Sequence Records

IP04554.complete Sequence

664 bp (664 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023667

> IP04554.complete
CGGATCGTCTGTAAAGCAACATCAATAAATAATATGGGAACTCGCAAGAA
GGGACTCGAATTCGCTAAACACATCACCGAGATTATCAACAAGTCAACGG
GCTTTGAAAGTCACCTACAGAAGGTCAAGATCGTAGACGGTGGCGATGGA
GCCTGCACTGCTGAGCTAAAGGTGGACCAGGATCATGTGAACTTGTACAA
GTTTTTGCACGGCGGTTATATCATGACCCTGGTGGACTTGATAACCACCT
ACGCCCTAATGTCCAAGCCATGTCATCCCGGAGTTTCGGTAGATCTTAGT
GTAAACTTTCTAAACGGCGCCAAACTGGGCGACGATGTGGTGATTCAGGC
CAATCTGTCCAAGGTGGGCAAGTACCTTGCCTTCATCGATTGCACCCTGA
AGCACAAGAAGGACGACTTGGTGATAGCCAAGGGCACACATCTAAAGTAT
ATCAAATTTGACTAGACTAGATAGTCTCAAATTGGGAGCTACTTCGTTTT
GAAAAATATTTTCGAAGCGCCCCAAGTAAGTTTCATAATTTGTACAAATA
AATGATTATGGGTTATTAATGTGCTTTATTTTATTACACGTGTAGCAGTA
CATTGTTAGTTAATTGTCAATTAAACATGCTCATTGCGCAAAAAAAAAAA
AAAAAAAAAAAAAA

IP04554.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG16986.a 769 CG16986.a 131..769 1..639 3195 100 Plus
CG16986-RA 642 CG16986-RA 123..642 1..520 2600 100 Plus
Pxn-RC 5197 Pxn-RC 5109..5197 641..553 445 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:31:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2600528..2601046 121..639 2595 100 Plus
chr3L 24539361 chr3L 2600347..2600471 1..125 625 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2601018..2601538 121..641 2605 100 Plus
3L 28110227 3L 2600837..2600961 1..125 625 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2601018..2601538 121..641 2605 100 Plus
3L 28103327 3L 2600837..2600961 1..125 625 100 Plus
Blast to na_te.dros performed 2019-03-15 21:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 32..122 588..500 117 64.9 Minus
1360 3409 1360 1360 3409bp 2408..2486 574..497 113 65.4 Minus

IP04554.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:32:21 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2600347..2600469 1..123 100 -> Plus
chr3L 2600531..2601046 124..639 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:33 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 1..432 34..465 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:53 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RB 1..432 34..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:51:30 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 1..432 34..465 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:22 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 1..432 34..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:56:32 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 1..432 34..465 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:25 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 1..432 34..465 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:53 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 95..733 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:51:30 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 131..769 1..639 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:22 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 1..432 34..465 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:56:32 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
CG16986-RA 131..769 1..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:21 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2600837..2600959 1..123 100 -> Plus
3L 2601021..2601536 124..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:21 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2600837..2600959 1..123 100 -> Plus
3L 2601021..2601536 124..639 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:32:21 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2600837..2600959 1..123 100 -> Plus
3L 2601021..2601536 124..639 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:51:30 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2600837..2600959 1..123 100 -> Plus
arm_3L 2601021..2601536 124..639 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:54 Download gff for IP04554.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2601021..2601536 124..639 100   Plus
3L 2600837..2600959 1..123 100 -> Plus

IP04554.hyp Sequence

Translation from 0 to 464

> IP04554.hyp
RIVCKATSINNMGTRKKGLEFAKHITEIINKSTGFESHLQKVKIVDGGDG
ACTAELKVDQDHVNLYKFLHGGYIMTLVDLITTYALMSKPCHPGVSVDLS
VNFLNGAKLGDDVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKY
IKFD*

IP04554.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG16986-PB 143 CG16986-PB 1..143 12..154 746 100 Plus
CG16986-PA 143 CG16986-PA 1..143 12..154 746 100 Plus
CG16985-PA 149 CG16985-PA 1..143 12..154 330 44.1 Plus

IP04554.pep Sequence

Translation from 33 to 464

> IP04554.pep
MGTRKKGLEFAKHITEIINKSTGFESHLQKVKIVDGGDGACTAELKVDQD
HVNLYKFLHGGYIMTLVDLITTYALMSKPCHPGVSVDLSVNFLNGAKLGD
DVVIQANLSKVGKYLAFIDCTLKHKKDDLVIAKGTHLKYIKFD*

IP04554.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:12:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24238-PA 143 GF24238-PA 1..143 1..143 671 88.1 Plus
Dana\GF24237-PA 153 GF24237-PA 1..143 1..143 340 44.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14876-PA 143 GG14876-PA 1..143 1..143 714 95.8 Plus
Dere\GG14875-PA 149 GG14875-PA 1..143 1..143 329 44.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16394-PA 143 GH16394-PA 1..143 1..143 541 69.2 Plus
Dgri\GH16393-PA 146 GH16393-PA 4..142 5..143 301 43.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG16986-PB 143 CG16986-PB 1..143 1..143 746 100 Plus
CG16986-PA 143 CG16986-PA 1..143 1..143 746 100 Plus
CG16985-PA 149 CG16985-PA 1..143 1..143 330 44.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12477-PA 143 GI12477-PA 1..143 1..143 538 69.2 Plus
Dmoj\GI12476-PA 139 GI12476-PA 3..134 12..143 312 43.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:12:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22460-PA 90 GL22460-PA 1..85 1..85 339 74.1 Plus
Dper\GL22458-PA 145 GL22458-PA 4..142 5..143 323 42.4 Plus
Dper\GL22459-PA 133 GL22459-PA 15..127 31..143 259 44.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14258-PA 144 GA14258-PA 1..142 1..142 597 76.1 Plus
Dpse\GA14257-PA 145 GA14257-PA 4..142 5..143 323 42.4 Plus
Dpse\GA24343-PA 148 GA24343-PA 4..142 5..143 294 42.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15032-PA 143 GM15032-PA 1..143 1..143 719 96.5 Plus
Dsec\GM15031-PA 149 GM15031-PA 1..143 1..143 336 44.8 Plus
Dsec\GM14498-PA 149 GM14498-PA 1..143 1..143 336 44.8 Plus
Dsec\GM14499-PA 96 GM14499-PA 5..90 58..143 229 50 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:12:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13696-PA 143 GD13696-PA 1..143 1..143 719 96.5 Plus
Dsim\GD13695-PA 149 GD13695-PA 1..143 1..143 331 44.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12379-PA 144 GJ12379-PA 1..143 1..143 547 69.9 Plus
Dvir\GJ12377-PA 135 GJ12377-PA 3..134 12..143 299 43.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12658-PA 143 GK12658-PA 1..143 1..143 549 71.3 Plus
Dwil\GK12657-PA 144 GK12657-PA 1..143 1..143 334 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:12:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20328-PA 143 GE20328-PA 1..143 1..143 714 95.8 Plus
Dyak\GE20327-PA 149 GE20327-PA 1..143 1..143 325 43.4 Plus