Clone IP04594 Report

Search the DGRC for IP04594

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:94
Vector:pOT2
Associated Gene/TranscriptCG31909-RB
Protein status:IP04594.pep: gold
Preliminary Size:478
Sequenced Size:602

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31909 2005-01-01 Successful iPCR screen
CG31909 2008-04-29 Release 5.5 accounting
CG31909 2008-08-15 Release 5.9 accounting
CG31909 2008-12-18 5.12 accounting

Clone Sequence Records

IP04594.complete Sequence

602 bp (602 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023668

> IP04594.complete
TCAAGTCCAAATAGACCCTACAGTCAGAAAACTTATATAGTGCGGTGAGT
GAGACAACAAGGTGCTGTCACCATCACCAACAAAAAAAATGGAACCCTCG
TTTTCCAATACTAACAAATCGGAACTTCAGAACCAACTACGAGTAGAGAG
AGCTCTGCAAGATAAATATTTAAAAGAATTTTCTTCAATGGCGGATGAGC
TAAATCACTTAATTGATGGCACTACTCCCAGCCATATTGAGACTTATGAA
TATTTGGACACTGTCGACACTGAAAGCGGTCGTTCTCTCGAAGAAGAGAA
AAAGTTAACTAACTTTTTCTATAAATTGAAGAGCGATCTACAGAAATTAT
ATAGAGAAATCGTAGAGAACCCAAAATATTTAAACGAAATCAGGGATTCA
ACTATTATAAGGGACAATATAGATTTACTGGATGAAGTAGACGCTTTTGA
AGGTTCGATGAATATGCTTTGACGGACAGGTGGGATTTGAAAAATGTAAA
AAAATTCGGGTGTTACTTTATTTTTTATGGTTAAAAAATAATAAAAGAAA
CAGGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

IP04594.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG31909-RB 561 CG31909-RB 2..557 1..556 2780 100 Plus
CG31909-RC 795 CG31909-RC 244..747 53..556 2520 100 Plus
CG31909-RC 795 CG31909-RC 119..171 1..53 265 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7256719..7257222 52..555 2520 100 Plus
chr2L 23010047 chr2L 7231206..7231659 505..52 2195 98.9 Minus
chr2L 23010047 chr2L 7256536..7256588 1..53 265 100 Plus
chr2L 23010047 chr2L 7231774..7231825 52..1 230 96.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7257695..7258199 52..556 2525 100 Plus
2L 23513712 2L 7232194..7232647 505..52 2210 99.1 Minus
2L 23513712 2L 7257512..7257564 1..53 265 100 Plus
2L 23513712 2L 7232762..7232813 52..1 230 96.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7257695..7258199 52..556 2525 100 Plus
2L 23513712 2L 7232194..7232647 505..52 2210 99.1 Minus
2L 23513712 2L 7257512..7257564 1..53 265 100 Plus
3L 28103327 3L 13573156..13573220 536..600 250 92.3 Plus
2L 23513712 2L 7232762..7232813 52..1 230 96.1 Minus
Blast to na_te.dros performed 2019-03-16 13:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 6855..7002 291..433 116 55.4 Plus

IP04594.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:22 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7256536..7256588 1..53 100 -> Plus
chr2L 7256721..7257222 54..555 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:42 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RC 1..384 89..472 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:40 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RC 1..384 89..472 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:46:55 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RB 1..384 89..472 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:07 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RA 1..384 89..472 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:34 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RB 1..384 89..472 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:02 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RB 1..555 1..555 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:40 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RB 1..555 1..555 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:46:55 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RB 1..555 1..555 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:07 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RA 67..478 61..472 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:34 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
CG31909-RB 1..555 1..555 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:22 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7257512..7257564 1..53 100 -> Plus
2L 7257697..7258198 54..555 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:22 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7257512..7257564 1..53 100 -> Plus
2L 7257697..7258198 54..555 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:22 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7257512..7257564 1..53 100 -> Plus
2L 7257697..7258198 54..555 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:46:55 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7257512..7257564 1..53 100 -> Plus
arm_2L 7257697..7258198 54..555 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:39 Download gff for IP04594.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7257697..7258198 54..555 100   Plus
2L 7257512..7257564 1..53 100 -> Plus

IP04594.hyp Sequence

Translation from 88 to 471

> IP04594.hyp
MEPSFSNTNKSELQNQLRVERALQDKYLKEFSSMADELNHLIDGTTPSHI
ETYEYLDTVDTESGRSLEEEKKLTNFFYKLKSDLQKLYREIVENPKYLNE
IRDSTIIRDNIDLLDEVDAFEGSMNML*

IP04594.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG31909-PC 127 CG31909-PC 1..127 1..127 646 100 Plus
CG31909-PB 127 CG31909-PB 1..127 1..127 646 100 Plus
CG43800-PB 127 CG43800-PB 1..127 1..127 638 98.4 Plus
CG43800-PA 127 CG43800-PA 1..127 1..127 638 98.4 Plus

IP04594.pep Sequence

Translation from 88 to 471

> IP04594.pep
MEPSFSNTNKSELQNQLRVERALQDKYLKEFSSMADELNHLIDGTTPSHI
ETYEYLDTVDTESGRSLEEEKKLTNFFYKLKSDLQKLYREIVENPKYLNE
IRDSTIIRDNIDLLDEVDAFEGSMNML*

IP04594.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31909-PC 127 CG31909-PC 1..127 1..127 646 100 Plus
CG31909-PB 127 CG31909-PB 1..127 1..127 646 100 Plus
CG43800-PB 127 CG43800-PB 1..127 1..127 638 98.4 Plus
CG43800-PA 127 CG43800-PA 1..127 1..127 638 98.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16355-PA 115 GM16355-PA 1..111 1..111 394 68.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23456-PA 112 GD23456-PA 1..112 1..112 389 67 Plus