IP04594.complete Sequence
602 bp (602 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023668
> IP04594.complete
TCAAGTCCAAATAGACCCTACAGTCAGAAAACTTATATAGTGCGGTGAGT
GAGACAACAAGGTGCTGTCACCATCACCAACAAAAAAAATGGAACCCTCG
TTTTCCAATACTAACAAATCGGAACTTCAGAACCAACTACGAGTAGAGAG
AGCTCTGCAAGATAAATATTTAAAAGAATTTTCTTCAATGGCGGATGAGC
TAAATCACTTAATTGATGGCACTACTCCCAGCCATATTGAGACTTATGAA
TATTTGGACACTGTCGACACTGAAAGCGGTCGTTCTCTCGAAGAAGAGAA
AAAGTTAACTAACTTTTTCTATAAATTGAAGAGCGATCTACAGAAATTAT
ATAGAGAAATCGTAGAGAACCCAAAATATTTAAACGAAATCAGGGATTCA
ACTATTATAAGGGACAATATAGATTTACTGGATGAAGTAGACGCTTTTGA
AGGTTCGATGAATATGCTTTGACGGACAGGTGGGATTTGAAAAATGTAAA
AAAATTCGGGTGTTACTTTATTTTTTATGGTTAAAAAATAATAAAAGAAA
CAGGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA
IP04594.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:46:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31909-RB | 561 | CG31909-RB | 2..557 | 1..556 | 2780 | 100 | Plus |
CG31909-RC | 795 | CG31909-RC | 244..747 | 53..556 | 2520 | 100 | Plus |
CG31909-RC | 795 | CG31909-RC | 119..171 | 1..53 | 265 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:37:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 7256719..7257222 | 52..555 | 2520 | 100 | Plus |
chr2L | 23010047 | chr2L | 7231206..7231659 | 505..52 | 2195 | 98.9 | Minus |
chr2L | 23010047 | chr2L | 7256536..7256588 | 1..53 | 265 | 100 | Plus |
chr2L | 23010047 | chr2L | 7231774..7231825 | 52..1 | 230 | 96.2 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:37:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7257695..7258199 | 52..556 | 2525 | 100 | Plus |
2L | 23513712 | 2L | 7232194..7232647 | 505..52 | 2210 | 99.1 | Minus |
2L | 23513712 | 2L | 7257512..7257564 | 1..53 | 265 | 100 | Plus |
2L | 23513712 | 2L | 7232762..7232813 | 52..1 | 230 | 96.2 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 7257695..7258199 | 52..556 | 2525 | 100 | Plus |
2L | 23513712 | 2L | 7232194..7232647 | 505..52 | 2210 | 99.1 | Minus |
2L | 23513712 | 2L | 7257512..7257564 | 1..53 | 265 | 100 | Plus |
3L | 28103327 | 3L | 13573156..13573220 | 536..600 | 250 | 92.3 | Plus |
2L | 23513712 | 2L | 7232762..7232813 | 52..1 | 230 | 96.1 | Minus |
Blast to na_te.dros performed 2019-03-16 13:37:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
ZAM | 8435 | ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). | 6855..7002 | 291..433 | 116 | 55.4 | Plus |
IP04594.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:38:22 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 7256536..7256588 | 1..53 | 100 | -> | Plus |
chr2L | 7256721..7257222 | 54..555 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:42 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RC | 1..384 | 89..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:40 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RC | 1..384 | 89..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:46:55 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RB | 1..384 | 89..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:07 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RA | 1..384 | 89..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:15:34 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RB | 1..384 | 89..472 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:02 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RB | 1..555 | 1..555 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:40 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RB | 1..555 | 1..555 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:46:55 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RB | 1..555 | 1..555 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:07 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RA | 67..478 | 61..472 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:15:34 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31909-RB | 1..555 | 1..555 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:22 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7257512..7257564 | 1..53 | 100 | -> | Plus |
2L | 7257697..7258198 | 54..555 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:22 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7257512..7257564 | 1..53 | 100 | -> | Plus |
2L | 7257697..7258198 | 54..555 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:38:22 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7257512..7257564 | 1..53 | 100 | -> | Plus |
2L | 7257697..7258198 | 54..555 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:46:55 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 7257512..7257564 | 1..53 | 100 | -> | Plus |
arm_2L | 7257697..7258198 | 54..555 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:39 Download gff for
IP04594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 7257697..7258198 | 54..555 | 100 | | Plus |
2L | 7257512..7257564 | 1..53 | 100 | -> | Plus |
IP04594.hyp Sequence
Translation from 88 to 471
> IP04594.hyp
MEPSFSNTNKSELQNQLRVERALQDKYLKEFSSMADELNHLIDGTTPSHI
ETYEYLDTVDTESGRSLEEEKKLTNFFYKLKSDLQKLYREIVENPKYLNE
IRDSTIIRDNIDLLDEVDAFEGSMNML*
IP04594.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:28:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31909-PC | 127 | CG31909-PC | 1..127 | 1..127 | 646 | 100 | Plus |
CG31909-PB | 127 | CG31909-PB | 1..127 | 1..127 | 646 | 100 | Plus |
CG43800-PB | 127 | CG43800-PB | 1..127 | 1..127 | 638 | 98.4 | Plus |
CG43800-PA | 127 | CG43800-PA | 1..127 | 1..127 | 638 | 98.4 | Plus |
IP04594.pep Sequence
Translation from 88 to 471
> IP04594.pep
MEPSFSNTNKSELQNQLRVERALQDKYLKEFSSMADELNHLIDGTTPSHI
ETYEYLDTVDTESGRSLEEEKKLTNFFYKLKSDLQKLYREIVENPKYLNE
IRDSTIIRDNIDLLDEVDAFEGSMNML*
IP04594.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31909-PC | 127 | CG31909-PC | 1..127 | 1..127 | 646 | 100 | Plus |
CG31909-PB | 127 | CG31909-PB | 1..127 | 1..127 | 646 | 100 | Plus |
CG43800-PB | 127 | CG43800-PB | 1..127 | 1..127 | 638 | 98.4 | Plus |
CG43800-PA | 127 | CG43800-PA | 1..127 | 1..127 | 638 | 98.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16355-PA | 115 | GM16355-PA | 1..111 | 1..111 | 394 | 68.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:10:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23456-PA | 112 | GD23456-PA | 1..112 | 1..112 | 389 | 67 | Plus |