Clone IP04595 Report

Search the DGRC for IP04595

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:45
Well:95
Vector:pOT2
Associated Gene/TranscriptCG31922-RA
Protein status:IP04595.pep: validated not full length
Preliminary Size:502
Sequenced Size:454

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31922 2005-01-01 Successful iPCR screen
CG31922 2008-04-29 Release 5.5 accounting
CG31922 2008-08-15 Release 5.9 accounting
CG31922 2008-12-18 5.12 accounting

Clone Sequence Records

IP04595.complete Sequence

454 bp (454 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022314

> IP04595.complete
AAAAGTTATTATTGCGACTACTGCTGTTGCTTTCTGAAAAACGATCTGAA
TGTGAGGAAATTGCACAATGGTGGTATTGCACACGCAATTGCAAAGAGCA
ACTATTTGAAGCGTTACGAGGATCCCAAAAAGATTTTGACTGAAGAGCGG
CAGAAAACTCCTTGCAAGCGATACTTTGGCAGTTACTGCAAGTTTGAAAC
ATATTGCAAGTTTACCCACTATAGTGGCGATAATCTACGGGAACTGGAGA
AGTTGGTTCTCGCTAGAAAGAAGAGAAAATCCCGAAAGAAAACCAACAAA
TGCAAGAGATGGCCCTGGAAAACTCATCTGCGAAAGGGATTACCCCCTTC
CTTGCAACCCATTAACCCGGAAAAACTCAAGCAAACCGACTTTGAACTCA
GTTGGGGCTAAATATATTTACAGAATGCACACTTTAAAAAAAAAAAAAAA
AAAA

IP04595.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG31922-RA 637 CG31922-RA 100..535 1..436 2180 100 Plus
CG5118-RA 1960 CG5118-RA 1922..1960 436..398 195 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1170542..1170721 256..435 900 100 Plus
chr2L 23010047 chr2L 1170350..1170485 121..256 680 100 Plus
chr2L 23010047 chr2L 1170175..1170295 1..121 605 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:42:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1170610..1170790 256..436 905 100 Plus
2L 23513712 2L 1170418..1170553 121..256 680 100 Plus
2L 23513712 2L 1170243..1170363 1..121 605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1170610..1170790 256..436 905 100 Plus
2L 23513712 2L 1170418..1170553 121..256 680 100 Plus
2L 23513712 2L 1170243..1170363 1..121 605 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:28:32 has no hits.

IP04595.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:29:38 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1170175..1170295 1..121 100 -> Plus
chr2L 1170351..1170485 122..256 100 -> Plus
chr2L 1170543..1170721 257..435 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:43 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 10..420 1..411 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:12 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 10..420 1..411 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:17 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 10..420 1..411 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:10 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 10..420 1..411 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:07 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 10..420 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:55 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 10..444 1..435 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:12 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 63..497 1..435 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:17 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 63..497 1..435 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:10 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 10..444 1..435 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:07 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
CG31922-RA 63..497 1..435 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:38 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1170243..1170363 1..121 100 -> Plus
2L 1170419..1170553 122..256 100 -> Plus
2L 1170611..1170789 257..435 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:38 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1170243..1170363 1..121 100 -> Plus
2L 1170419..1170553 122..256 100 -> Plus
2L 1170611..1170789 257..435 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:38 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1170243..1170363 1..121 100 -> Plus
2L 1170419..1170553 122..256 100 -> Plus
2L 1170611..1170789 257..435 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:17 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1170243..1170363 1..121 100 -> Plus
arm_2L 1170419..1170553 122..256 100 -> Plus
arm_2L 1170611..1170789 257..435 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:29 Download gff for IP04595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1170611..1170789 257..435 100   Plus
2L 1170243..1170363 1..121 100 -> Plus
2L 1170419..1170553 122..256 100 -> Plus

IP04595.pep Sequence

Translation from 0 to 410

> IP04595.pep
KSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEER
QKTPCKRYFGSYCKFETYCKFTHYSGDNLRELEKLVLARKKRKSRKKTNK
CKRWPWKTHLRKGLPPSLQPINPEKLKQTDFELSWG*

IP04595.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15171-PA 138 GF15171-PA 4..138 1..136 463 62.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24775-PA 137 GG24775-PA 4..137 1..136 591 81.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11400-PA 132 GH11400-PA 4..132 1..136 378 53.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG31922-PA 139 CG31922-PA 4..139 1..136 766 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14532-PA 133 GI14532-PA 4..133 1..136 385 56.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:45:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15614-PA 135 GL15614-PA 3..135 1..136 441 60.3 Plus
Dper\GL15604-PA 135 GL15604-PA 3..135 1..136 441 60.3 Plus
Dper\GL10067-PA 87 GL10067-PA 3..60 1..58 225 65.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22198-PA 135 GA22198-PA 3..135 1..136 441 60.3 Plus
Dpse\GA16568-PA 135 GA16568-PA 3..135 1..136 441 60.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16802-PA 138 GM16802-PA 4..138 1..136 657 91.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23078-PA 138 GD23078-PA 4..138 1..136 654 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16945-PA 132 GJ16945-PA 4..132 1..136 355 56.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19044-PA 135 GK19044-PA 4..134 1..135 381 51.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17407-PA 138 GE17407-PA 4..138 1..136 522 80.1 Plus

IP04595.hyp Sequence

Translation from 0 to 410

> IP04595.hyp
KSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEER
QKTPCKRYFGSYCKFETYCKFTHYSGDNLRELEKLVLARKKRKSRKKTNK
CKRWPWKTHLRKGLPPSLQPINPEKLKQTDFELSWG*

IP04595.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG31922-PA 139 CG31922-PA 4..139 1..136 766 100 Plus