BDGP Sequence Production Resources |
Search the DGRC for IP04595
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 45 |
Well: | 95 |
Vector: | pOT2 |
Associated Gene/Transcript | CG31922-RA |
Protein status: | IP04595.pep: validated not full length |
Preliminary Size: | 502 |
Sequenced Size: | 454 |
Gene | Date | Evidence |
---|---|---|
CG31922 | 2005-01-01 | Successful iPCR screen |
CG31922 | 2008-04-29 | Release 5.5 accounting |
CG31922 | 2008-08-15 | Release 5.9 accounting |
CG31922 | 2008-12-18 | 5.12 accounting |
454 bp (454 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022314
> IP04595.complete AAAAGTTATTATTGCGACTACTGCTGTTGCTTTCTGAAAAACGATCTGAA TGTGAGGAAATTGCACAATGGTGGTATTGCACACGCAATTGCAAAGAGCA ACTATTTGAAGCGTTACGAGGATCCCAAAAAGATTTTGACTGAAGAGCGG CAGAAAACTCCTTGCAAGCGATACTTTGGCAGTTACTGCAAGTTTGAAAC ATATTGCAAGTTTACCCACTATAGTGGCGATAATCTACGGGAACTGGAGA AGTTGGTTCTCGCTAGAAAGAAGAGAAAATCCCGAAAGAAAACCAACAAA TGCAAGAGATGGCCCTGGAAAACTCATCTGCGAAAGGGATTACCCCCTTC CTTGCAACCCATTAACCCGGAAAAACTCAAGCAAACCGACTTTGAACTCA GTTGGGGCTAAATATATTTACAGAATGCACACTTTAAAAAAAAAAAAAAA AAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 1170542..1170721 | 256..435 | 900 | 100 | Plus |
chr2L | 23010047 | chr2L | 1170350..1170485 | 121..256 | 680 | 100 | Plus |
chr2L | 23010047 | chr2L | 1170175..1170295 | 1..121 | 605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 1170175..1170295 | 1..121 | 100 | -> | Plus |
chr2L | 1170351..1170485 | 122..256 | 100 | -> | Plus |
chr2L | 1170543..1170721 | 257..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 10..420 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 10..420 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 10..420 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 10..420 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 10..420 | 1..411 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 10..444 | 1..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 63..497 | 1..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 63..497 | 1..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 10..444 | 1..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG31922-RA | 63..497 | 1..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1170243..1170363 | 1..121 | 100 | -> | Plus |
2L | 1170419..1170553 | 122..256 | 100 | -> | Plus |
2L | 1170611..1170789 | 257..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1170243..1170363 | 1..121 | 100 | -> | Plus |
2L | 1170419..1170553 | 122..256 | 100 | -> | Plus |
2L | 1170611..1170789 | 257..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1170243..1170363 | 1..121 | 100 | -> | Plus |
2L | 1170419..1170553 | 122..256 | 100 | -> | Plus |
2L | 1170611..1170789 | 257..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 1170243..1170363 | 1..121 | 100 | -> | Plus |
arm_2L | 1170419..1170553 | 122..256 | 100 | -> | Plus |
arm_2L | 1170611..1170789 | 257..435 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1170611..1170789 | 257..435 | 100 | Plus | |
2L | 1170243..1170363 | 1..121 | 100 | -> | Plus |
2L | 1170419..1170553 | 122..256 | 100 | -> | Plus |
Translation from 0 to 410
> IP04595.pep KSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEER QKTPCKRYFGSYCKFETYCKFTHYSGDNLRELEKLVLARKKRKSRKKTNK CKRWPWKTHLRKGLPPSLQPINPEKLKQTDFELSWG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15171-PA | 138 | GF15171-PA | 4..138 | 1..136 | 463 | 62.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24775-PA | 137 | GG24775-PA | 4..137 | 1..136 | 591 | 81.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11400-PA | 132 | GH11400-PA | 4..132 | 1..136 | 378 | 53.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31922-PA | 139 | CG31922-PA | 4..139 | 1..136 | 766 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14532-PA | 133 | GI14532-PA | 4..133 | 1..136 | 385 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15614-PA | 135 | GL15614-PA | 3..135 | 1..136 | 441 | 60.3 | Plus |
Dper\GL15604-PA | 135 | GL15604-PA | 3..135 | 1..136 | 441 | 60.3 | Plus |
Dper\GL10067-PA | 87 | GL10067-PA | 3..60 | 1..58 | 225 | 65.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22198-PA | 135 | GA22198-PA | 3..135 | 1..136 | 441 | 60.3 | Plus |
Dpse\GA16568-PA | 135 | GA16568-PA | 3..135 | 1..136 | 441 | 60.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16802-PA | 138 | GM16802-PA | 4..138 | 1..136 | 657 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23078-PA | 138 | GD23078-PA | 4..138 | 1..136 | 654 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16945-PA | 132 | GJ16945-PA | 4..132 | 1..136 | 355 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19044-PA | 135 | GK19044-PA | 4..134 | 1..135 | 381 | 51.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17407-PA | 138 | GE17407-PA | 4..138 | 1..136 | 522 | 80.1 | Plus |
Translation from 0 to 410
> IP04595.hyp KSYYCDYCCCFLKNDLNVRKLHNGGIAHAIAKSNYLKRYEDPKKILTEER QKTPCKRYFGSYCKFETYCKFTHYSGDNLRELEKLVLARKKRKSRKKTNK CKRWPWKTHLRKGLPPSLQPINPEKLKQTDFELSWG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG31922-PA | 139 | CG31922-PA | 4..139 | 1..136 | 766 | 100 | Plus |