Clone IP04606 Report

Search the DGRC for IP04606

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:6
Vector:pOT2
Associated Gene/TranscriptCG14671-RA
Protein status:IP04606.pep: gold
Preliminary Size:468
Sequenced Size:583

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14671 2005-01-01 Successful iPCR screen
CG14671 2008-04-29 Release 5.5 accounting
CG14671 2008-08-15 Release 5.9 accounting
CG14671 2008-12-18 5.12 accounting

Clone Sequence Records

IP04606.complete Sequence

583 bp (583 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023665

> IP04606.complete
AAATAAAGTTATTCCTCAGCCCGCAATGAGCATTCAAAGAAGCGAAAAGG
AGGCCGCGGGCCAGCTACTGGATGACTTGTACCTGGACATGTTCCACCTC
GTTGAGGAGCACACCCAGTGTCGGATAAATTTGGAGCGATGTAACGCCAG
TGGGGCGATTCTCCTGGCCCGCACTAGATTTCAGCACGGAGGCAGCCAGT
GCGTGTCCACGGCCCAGATTCCCACGGAGAACAGTGCCGAGTTTAACGCC
CTCTGCCGGGTCGTGGACTCCACGGATGGCGTCTGCATCGAGCGACAGGC
GGTTGACAAGTCCAAGGGCTTCGTGGAGCCCCTGCATTGGTTCTCGGTAC
TGCCACCGATGAGCTTGCGCAATGCTGTTAACAAGTTCAAGGACTGCATA
GAGCTGGTCGCCGAGAGCACTAATCTGCAGCGGCAGCTAGGAGAAGCGCT
GGATTCGATCACAAAGCTGCGAAGGAGTGCCCTGCTTAGCTAGATACTTA
TGGCGCGCACACAATCCATACAATGTTAAGAATAAAGTAGATTTGAAAAC
ATTATTGAAACAGCAAAAAAAAAAAAAAAAAAA

IP04606.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14671-RA 845 CG14671-RA 116..680 1..565 2825 100 Plus
CG14671.a 993 CG14671.a 84..648 1..565 2825 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:09:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1390064..1390409 346..1 1730 100 Minus
chr3R 27901430 chr3R 1389781..1389999 564..346 1095 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:09:23
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5564405..5564750 346..1 1730 100 Minus
3R 32079331 3R 5564121..5564340 565..346 1100 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5305236..5305581 346..1 1730 100 Minus
3R 31820162 3R 5304952..5305171 565..346 1100 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:09:24 has no hits.

IP04606.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:10:38 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1389781..1389999 346..564 100 <- Minus
chr3R 1390065..1390402 8..345 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:45 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 1..468 26..493 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:41 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 1..468 26..493 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:55:03 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 1..468 26..493 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:08 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 1..468 26..493 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:29 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 1..468 26..493 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:04 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 1..468 26..493 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:41 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 66..629 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:55:03 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 66..629 1..564 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:08 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 1..468 26..493 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:29 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
CG14671-RA 66..629 1..564 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:38 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5564122..5564340 346..564 100 <- Minus
3R 5564406..5564750 1..345 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:38 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5564122..5564340 346..564 100 <- Minus
3R 5564406..5564750 1..345 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:10:38 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5564122..5564340 346..564 100 <- Minus
3R 5564406..5564750 1..345 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:55:03 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1389844..1390062 346..564 100 <- Minus
arm_3R 1390128..1390472 1..345 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:41 Download gff for IP04606.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5304953..5305171 346..564 100 <- Minus
3R 5305237..5305581 1..345 100   Minus

IP04606.hyp Sequence

Translation from 0 to 492

> IP04606.hyp
NKVIPQPAMSIQRSEKEAAGQLLDDLYLDMFHLVEEHTQCRINLERCNAS
GAILLARTRFQHGGSQCVSTAQIPTENSAEFNALCRVVDSTDGVCIERQA
VDKSKGFVEPLHWFSVLPPMSLRNAVNKFKDCIELVAESTNLQRQLGEAL
DSITKLRRSALLS*

IP04606.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14671-PB 155 CG14671-PB 1..155 9..163 792 100 Plus
CG14671-PA 155 CG14671-PA 1..155 9..163 792 100 Plus

IP04606.pep Sequence

Translation from 25 to 492

> IP04606.pep
MSIQRSEKEAAGQLLDDLYLDMFHLVEEHTQCRINLERCNASGAILLART
RFQHGGSQCVSTAQIPTENSAEFNALCRVVDSTDGVCIERQAVDKSKGFV
EPLHWFSVLPPMSLRNAVNKFKDCIELVAESTNLQRQLGEALDSITKLRR
SALLS*

IP04606.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11637-PA 157 GF11637-PA 1..156 1..154 672 80.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10958-PA 155 GG10958-PA 1..155 1..155 737 89.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22278-PA 157 GH22278-PA 5..156 6..154 562 68 Plus
Dgri\GH17101-PA 208 GH17101-PA 53..199 7..149 204 33.1 Plus
Dgri\GH25226-PA 208 GH25226-PA 55..199 9..149 204 33.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14671-PB 155 CG14671-PB 1..155 1..155 792 100 Plus
CG14671-PA 155 CG14671-PA 1..155 1..155 792 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23085-PA 134 GI23085-PA 1..133 22..154 470 64.9 Plus
Dmoj\GI11707-PA 198 GI11707-PA 35..188 9..148 174 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:10:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22152-PA 157 GL22152-PA 1..155 1..153 611 74.2 Plus
Dper\GL22154-PA 155 GL22154-PA 1..153 1..153 608 74.2 Plus
Dper\GL19706-PA 123 GL19706-PA 1..111 1..106 343 62.5 Plus
Dper\GL21015-PA 174 GL21015-PA 18..169 6..154 217 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:10:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13164-PA 157 GA13164-PA 1..155 1..153 607 73.5 Plus
Dpse\GA21899-PA 174 GA21899-PA 18..166 6..151 213 35.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10618-PA 155 GM10618-PA 1..155 1..155 768 94.2 Plus
Dsec\GM25467-PA 178 GM25467-PA 21..165 6..149 151 35.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:10:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19606-PA 155 GD19606-PA 1..155 1..155 778 95.5 Plus
Dsim\GD17947-PA 180 GD17947-PA 21..167 6..149 152 34.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22706-PA 161 GJ22706-PA 1..156 1..150 521 63.7 Plus
Dvir\GJ11381-PA 179 GJ11381-PA 27..169 9..148 170 31.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18962-PA 160 GK18962-PA 1..155 1..150 571 67.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24163-PA 155 GE24163-PA 1..155 1..155 745 89.7 Plus