Clone IP04615 Report

Search the DGRC for IP04615

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:15
Vector:pOT2
Associated Gene/TranscriptCG14983-RA
Protein status:IP04615.pep: gold
Preliminary Size:492
Sequenced Size:632

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14983 2005-01-01 Successful iPCR screen
CG14983 2008-04-29 Release 5.5 accounting
CG14983 2008-08-15 Release 5.9 accounting
CG14983 2008-12-18 5.12 accounting

Clone Sequence Records

IP04615.complete Sequence

632 bp (632 high quality bases) assembled on 2006-04-13

GenBank Submission: BT025146

> IP04615.complete
TTCATTCAGAAAAATGTTACATCTACCGAAAATTGTCGACTTGTTGAAGG
AGCTGCAAGAGCAGGAGAAAGAAATTCAAGAGATCATTCTCGAGGAGAGC
TTCGCCAGTCCAGAACAGCGACTAGCCCAACTGGAATCGGTCACGTCACG
GATGCATCTATACCATTCAAGGCGCGGGAATATTCTAATGAGTTTGCAGC
AAGAGCTAGGCAAATATGAGTACTTCACTCTGCTGGTGAGGCACATTGCC
CAGACGCACAGCTATTTGAAATCGCTCAACAAGGCACTGGACTTCCTGTA
CAAAGTCAACATCTGCTCCATCTGCGATTTGAAATGTGAGCCGCATGGCA
GGCATTCCATGGTGTCCCTGCGTTGTGGCCACCTCTTTGGGCGCCACTGC
ATCAACAACGTCCTGCGGGAGAGCTCTCGGTGCCCCACTTGCTCGCGAAG
AGCCCGTCATCACGAAGTCCGCAGGATCTACGGCTTAAAGTTTTATCCTC
TTTAAGCTGCGTTGAATTAATTGAATTACATTTTGTTCTTATGAAACAAG
AATCTTACGCATCCTTAGCGACAATAAAATTTTCAGAATTGAAAGTATTT
TCAAATTAAAAAAAAAAAAAAAAAAAAAAAAA

IP04615.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG14983-RA 611 CG14983-RA 1..611 1..611 3040 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3948106..3948712 607..1 2990 99.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3948695..3949305 611..1 3040 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3948695..3949305 611..1 3040 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 01:17:15 has no hits.

IP04615.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:18:25 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3948106..3948712 1..607 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:47 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..492 14..505 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:51:01 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..492 14..505 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:45 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..492 14..505 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:42 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..492 14..505 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:29:47 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..492 14..505 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:24:47 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..607 1..607 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:51:01 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..607 1..607 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:45 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..607 1..607 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:42 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..607 1..607 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:29:47 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
CG14983-RA 1..607 1..607 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:25 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948699..3949305 1..607 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:25 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948699..3949305 1..607 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:25 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948699..3949305 1..607 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:45 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3948699..3949305 1..607 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:10:13 Download gff for IP04615.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3948699..3949305 1..607 99   Minus

IP04615.hyp Sequence

Translation from 0 to 504

> IP04615.hyp
SFRKMLHLPKIVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSR
MHLYHSRRGNILMSLQQELGKYEYFTLLVRHIAQTHSYLKSLNKALDFLY
KVNICSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSRCPTCSRR
ARHHEVRRIYGLKFYPL*

IP04615.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14983-PA 163 CG14983-PA 1..163 5..167 859 100 Plus
CG17329-PA 162 CG17329-PA 6..159 16..164 257 40.8 Plus
CG13481-PC 176 CG13481-PC 35..170 30..160 217 35.3 Plus
CG13481-PB 176 CG13481-PB 35..170 30..160 217 35.3 Plus

IP04615.pep Sequence

Translation from 13 to 504

> IP04615.pep
MLHLPKIVDLLKELQEQEKEIQEIILEESFASPEQRLAQLESVTSRMHLY
HSRRGNILMSLQQELGKYEYFTLLVRHIAQTHSYLKSLNKALDFLYKVNI
CSICDLKCEPHGRHSMVSLRCGHLFGRHCINNVLRESSRCPTCSRRARHH
EVRRIYGLKFYPL*

IP04615.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11644-PA 261 GF11644-PA 26..191 3..156 187 31.4 Plus
Dana\GF20023-PA 161 GF20023-PA 22..159 38..162 163 31.9 Plus
Dana\GF21156-PA 369 GF21156-PA 307..368 101..162 151 41.9 Plus
Dana\GF10504-PA 763 GF10504-PA 283..345 101..157 141 44.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14234-PA 163 GG14234-PA 1..163 1..163 513 65.6 Plus
Dere\GG25198-PA 177 GG25198-PA 15..174 10..160 227 37 Plus
Dere\GG13729-PA 176 GG13729-PA 35..174 26..160 213 37.9 Plus
Dere\GG21800-PA 134 GG21800-PA 54..126 85..157 171 47.9 Plus
Dere\GG20119-PA 156 GG20119-PA 17..150 8..155 152 29.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13524-PA 158 GH13524-PA 53..154 57..155 139 32.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG14983-PA 163 CG14983-PA 1..163 1..163 859 100 Plus
CG17329-PA 162 CG17329-PA 6..159 12..160 257 40.8 Plus
CG13481-PC 176 CG13481-PC 35..170 26..156 217 35.3 Plus
CG13481-PB 176 CG13481-PB 35..170 26..156 217 35.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13216-PA 214 GI13216-PA 154..211 100..157 150 48.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15113-PA 259 GL15113-PA 50..256 11..162 163 26.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25508-PA 301 GA25508-PA 233..298 97..162 157 43.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:58:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14026-PA 163 GM14026-PA 1..163 1..163 728 85.3 Plus
Dsec\GM18662-PA 176 GM18662-PA 16..170 4..157 235 38.3 Plus
Dsec\GM18080-PA 164 GM18080-PA 66..148 78..160 153 37.3 Plus
Dsec\GM17193-PA 156 GM17193-PA 15..145 7..157 141 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13307-PA 163 GD13307-PA 1..163 1..163 601 72.4 Plus
Dsim\GD24047-PA 176 GD24047-PA 16..170 4..157 234 38.3 Plus
Dsim\GD22698-PA 164 GD22698-PA 77..148 89..160 162 44.4 Plus
Dsim\GD24069-PA 1318 GD24069-PA 15..131 7..143 143 34.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11989-PA 96 GJ11989-PA 1..93 59..157 141 37.4 Plus
Dvir\GJ13368-PA 265 GJ13368-PA 206..263 101..158 140 48.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:58:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20662-PA 164 GE20662-PA 1..164 1..163 479 61.6 Plus
Dyak\GE20024-PA 176 GE20024-PA 40..171 31..157 211 37.2 Plus
Dyak\GE11876-PA 220 GE11876-PA 24..219 3..156 201 28.6 Plus
Dyak\GE13175-PA 154 GE13175-PA 34..148 34..155 147 31.2 Plus
Dyak\GE14698-PA 263 GE14698-PA 130..229 61..158 147 32 Plus