Clone IP04631 Report

Search the DGRC for IP04631

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:31
Vector:pOT2
Associated Gene/TranscriptObp8a-RA
Protein status:IP04631.pep: gold
Preliminary Size:489
Sequenced Size:1312

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15368 2005-01-01 Successful iPCR screen
Obp8a 2008-08-15 Release 5.9 accounting
Obp8a 2008-12-18 5.12 accounting

Clone Sequence Records

IP04631.complete Sequence

1312 bp (1313 high quality bases) assembled on 2009-07-10

GenBank Submission: BT025143

> IP04631.complete
CCGATGACATCGCCGTGGGAATGATGCGGAGATCACAGATCGGTTTGCTC
AGCAGGCTGCTGCTGTTGCTGCTGGTGGTGGAACTGACGCCCCCTGCTAT
TCCGGTGCCCATGCGATCCTCACCCCAATCGCTGGCCCTACTGCGAGCAC
GGGATCAGTGCGGCAGGGAGCTGACTGCTGCCCAGCGTCTGCAGCTGGAC
AGGATGCAATTCGAGGATGCTGCCCATGTGCGTCACTATCTCCATTGCTT
CTGGTCACGGCTGCAGCTCTGGCTGGATGAGACCGGATTCCAGGCACAGC
GCATCGTTCAGAGTTTCGGCGGCGAGAGGCGTCTCAATGTGGAGCAGGCA
CTGCCAGCCATCAACGGGTGCAATGCGAAAACGAGCTCCAGAGGATCGGG
CGCTCAGACAGTGGTCGACTGGTGTTTCCGTGCCTTTGTCTGCGTGCTGG
CCACTCCAGTCGGTGAGTGGTACAAGCGCCACATGTCCGATGTCATCAAT
GGGAATGCCTAGAAATATGTACATATACAATTCTAGCTATTGTGACATAG
CTAAATATATAGACAAATGAATAAAAGTTGCAAGAAAACACGGATTGAAA
GTCATATGCGAAGTGTAAAGTGTAAAGACGATCGTTTCAAACTTGGTTTT
AAAAGTCAAAAACCATTTTTGTTTTCGACCACAACTGTATAGTAGGCCAC
AGATGCTAAATTAATAAATATGCTACAATAGACCGCATTTCGGAGCCTGT
GTGCGATATTCAGAAAACCAGGAAATATGCGAAGCGCAAGCGTACCGAAT
ATCATCATCTGGAGCGGCATGGATGCAGGCACCCAGTCGGCGATGTCAAT
TCAGCTGCATGGATTTAGCCACCATCTGGAGCAGCGGGATCAGGAAGAAC
GCGACCAGGGCGACGCACAAGAGCAGCAGCAGCCGCAGCAGCAGCAGGAT
CAACCGCCGATGGAAGAGCAGGATTCGAGGGCGGTTAACAGCAAGGATGG
TGCCGCCAATCAGGACACATCCGCCCATTCCGGCCAGGATCAAGATGGTA
ATCAGGCACAGGATTCCACAAAAAAACGATGCGACAAGTGCGGCAAGAAG
CTTGGCATCACCGGCGGATTCCCTTGTCGTTGTGGTGGCACCTATTGCGC
CGTCCACCGCTACAGTGATCGCCATGAATGCAATTTCGACTATCGCCAAA
TGGGCGCCATCCAAATCCGGCGTGATAATCCCGTCGTTGTCGCCAGCAAA
CTCCGAAAGCTTAAAACCAAACCAACCAAGTATTTATTGGGATCTCAGTC
AGTCTAAGATTT

IP04631.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Obp8a-RA 765 Obp8a-RA 89..765 1..677 3385 100 Plus
CG15368-RA 489 CG15368-RA 1..486 777..1262 2415 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:24:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9106961..9108165 59..1262 5855 99.3 Plus
chrX 22417052 chrX 9106681..9106734 3..56 270 100 Plus
chrX 22417052 chrX 9108225..9108276 1312..1261 260 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9215158..9216364 56..1262 6020 99.9 Plus
X 23542271 X 9214876..9214931 1..56 280 100 Plus
X 23542271 X 9216424..9216475 1312..1261 260 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9223256..9224462 56..1262 6020 99.9 Plus
X 23527363 X 9222974..9223029 1..56 280 100 Plus
X 23527363 X 9224522..9224573 1312..1261 260 100 Minus
Blast to na_te.dros performed 2019-03-15 23:24:13
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1097..1145 105..56 121 74 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6774..6818 101..56 119 76.1 Minus

IP04631.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:24:51 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9106678..9106738 1..59 95 -> Plus
chrX 9106962..9108182 60..1279 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:49:53 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..492 21..512 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:56:49 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..492 21..512 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:40:53 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..492 21..512 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed on 2008-07-21 16:37:41 has no hits.
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:33:13 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..492 21..512 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-10 10:26:45 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..580 21..600 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:56:49 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..580 21..600 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:40:53 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..600 1..600 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:37:41 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..580 714..1293 100   Minus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:33:13 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
Obp8a-RA 1..597 1..597 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:51 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
X 9214876..9214931 1..56 100 -> Plus
X 9215159..9216381 57..1279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:51 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
X 9214876..9214931 1..56 100 -> Plus
X 9215159..9216381 57..1279 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:24:51 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
X 9214876..9214931 1..56 100 -> Plus
X 9215159..9216381 57..1279 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:40:53 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9108909..9108964 1..56 100 -> Plus
arm_X 9109192..9110414 57..1279 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:16:12 Download gff for IP04631.complete
Subject Subject Range Query Range Percent Splice Strand
X 9223257..9224479 57..1279 99   Plus
X 9222974..9223029 1..56 100 -> Plus

IP04631.hyp Sequence

Translation from 2 to 511

> IP04631.hyp
DDIAVGMMRRSQIGLLSRLLLLLLVVELTPPAIPVPMRSSPQSLALLRAR
DQCGRELTAAQRLQLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQR
IVQSFGGERRLNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVLA
TPVGEWYKRHMSDVINGNA*

IP04631.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:25
Subject Length Description Subject Range Query Range Score Percent Strand
Obp8a-PA 163 CG12665-PA 1..163 7..169 851 100 Plus

IP04631.pep Sequence

Translation from 2 to 511

> IP04631.pep
DDIAVGMMRRSQIGLLSRLLLLLLVVELTPPAIPVPMRSSPQSLALLRAR
DQCGRELTAAQRLQLDRMQFEDAAHVRHYLHCFWSRLQLWLDETGFQAQR
IVQSFGGERRLNVEQALPAINGCNAKTSSRGSGAQTVVDWCFRAFVCVLA
TPVGEWYKRHMSDVINGNA*

IP04631.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18298-PA 158 GG18298-PA 15..158 25..169 655 83.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Obp8a-PA 163 CG12665-PA 1..163 7..169 851 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15510-PA 220 GI15510-PA 92..220 40..169 424 60.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26834-PA 164 GL26834-PA 32..164 34..169 504 68.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:41:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp8a-PA 164 GA11747-PA 32..164 34..169 501 68.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11660-PA 159 GM11660-PA 1..159 7..169 779 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:41:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp8a-PA 159 GD16939-PA 1..159 7..169 792 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp8a-PA 195 GJ19268-PA 39..195 19..169 419 53.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:41:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25385-PA 155 GK25385-PA 20..155 31..169 385 53.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17778-PA 160 GE17778-PA 1..160 5..169 705 84.8 Plus