Clone IP04634 Report

Search the DGRC for IP04634

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:34
Vector:pOT2
Associated Gene/TranscriptCG15394-RC
Protein status:IP04634.pep: gold
Preliminary Size:444
Sequenced Size:605

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15394 2005-01-01 Successful iPCR screen
CG15394 2008-04-29 Release 5.5 accounting
CG15394 2008-08-15 Release 5.9 accounting
CG15394 2008-12-18 5.12 accounting

Clone Sequence Records

IP04634.complete Sequence

605 bp (605 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022301

> IP04634.complete
GAATCTCGGCTAGCAAACAGGTTGCTCTCGCAATGAGGAAAATGCAAATA
TTGGGATTTCTGTTCATGTGGGCTCTTATTTGCCTTGGCAGTTGTTTCGC
CTATCCCAGGGCAAAGACCTCGTACGTAAATGACTTTGTATTCCCCACCG
AAGATGAGCAAGTCATTCGCCCCTGGCAGCAGTACTCAAATGAACACTCA
TCGCAGTCCAGAGACTTGAAACTGGCCAAATGCACTGACTTCCAGCTGGA
CAACGCTTCTGGCAATGCTCGTCTGATCTTCATCAGCTACAAGAAAGTGG
ATGATCCTCTACAGAGCCTAAAAAAGGCACTACTTGAGGAGCTGAATCTT
CCGGAACTTGTGGTCAGCCTAAAAGTGGTGAGGAGTGGGAAAAACCGCTT
AGTTTTTGAGCTGCCAAGTGCTCTGGATGCCCTCTTCACTCTGAATAGTT
TCTGCAATCGGTATCGCGATCGTCACGATCTCACCTATGAAATCATCAGC
GTTCAGAAGTGATTAAGTAATTAGACTTGACTTAGTATTGTAACATATAT
TGGTTAATAAAGTAAGAGAATGAGATGATTTTCAAACAAAAAAAAAAAAA
AAAAA

IP04634.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15394.a 874 CG15394.a 199..787 1..589 2945 100 Plus
CG15394-RB 722 CG15394-RB 47..635 1..589 2945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2592084..2592568 103..587 2425 100 Plus
chr2L 23010047 chr2L 2591923..2592024 1..102 480 98 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2592289..2592775 103..589 2435 100 Plus
2L 23513712 2L 2592128..2592229 1..102 510 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2592289..2592775 103..589 2435 100 Plus
2L 23513712 2L 2592128..2592229 1..102 510 100 Plus
Blast to na_te.dros performed on 2019-03-16 23:28:56 has no hits.

IP04634.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:29:58 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2591923..2592024 1..102 98 -> Plus
chr2L 2592084..2592568 103..587 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:51 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RB 47..558 1..512 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:52 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RB 47..558 1..512 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:50 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RC 1..480 33..512 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:53 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RB 47..558 1..512 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:47 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RC 1..480 33..512 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:33 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RB 47..633 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:52 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RB 47..633 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:50 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RC 1..587 1..587 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:53 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RB 47..633 1..587 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:47 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
CG15394-RC 1..587 1..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:58 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2592128..2592229 1..102 100 -> Plus
2L 2592289..2592773 103..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:58 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2592128..2592229 1..102 100 -> Plus
2L 2592289..2592773 103..587 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:58 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2592128..2592229 1..102 100 -> Plus
2L 2592289..2592773 103..587 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:50 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2592128..2592229 1..102 100 -> Plus
arm_2L 2592289..2592773 103..587 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:08 Download gff for IP04634.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2592289..2592773 103..587 100   Plus
2L 2592128..2592229 1..102 100 -> Plus

IP04634.pep Sequence

Translation from 2 to 511

> IP04634.pep
ISASKQVALAMRKMQILGFLFMWALICLGSCFAYPRAKTSYVNDFVFPTE
DEQVIRPWQQYSNEHSSQSRDLKLAKCTDFQLDNASGNARLIFISYKKVD
DPLQSLKKALLEELNLPELVVSLKVVRSGKNRLVFELPSALDALFTLNSF
CNRYRDRHDLTYEIISVQK*

IP04634.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24866-PA 144 GG24866-PA 12..144 35..168 548 76.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15394-PD 159 CG15394-PD 1..159 11..169 823 100 Plus
CG15394-PC 159 CG15394-PC 1..159 11..169 823 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11931-PA 155 GM11931-PA 21..155 35..169 677 94.8 Plus
Dsec\GM18348-PA 155 GM18348-PA 21..155 35..169 677 94.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23163-PA 145 GD23163-PA 11..145 35..169 671 94.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:45:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17362-PA 163 GJ17362-PA 6..159 20..169 139 28.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18164-PA 146 GE18164-PA 16..146 34..169 516 73.5 Plus

IP04634.hyp Sequence

Translation from 2 to 511

> IP04634.hyp
ISASKQVALAMRKMQILGFLFMWALICLGSCFAYPRAKTSYVNDFVFPTE
DEQVIRPWQQYSNEHSSQSRDLKLAKCTDFQLDNASGNARLIFISYKKVD
DPLQSLKKALLEELNLPELVVSLKVVRSGKNRLVFELPSALDALFTLNSF
CNRYRDRHDLTYEIISVQK*

IP04634.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15394-PD 159 CG15394-PD 1..159 11..169 823 100 Plus
CG15394-PC 159 CG15394-PC 1..159 11..169 823 100 Plus