IP04634.complete Sequence
605 bp (605 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022301
> IP04634.complete
GAATCTCGGCTAGCAAACAGGTTGCTCTCGCAATGAGGAAAATGCAAATA
TTGGGATTTCTGTTCATGTGGGCTCTTATTTGCCTTGGCAGTTGTTTCGC
CTATCCCAGGGCAAAGACCTCGTACGTAAATGACTTTGTATTCCCCACCG
AAGATGAGCAAGTCATTCGCCCCTGGCAGCAGTACTCAAATGAACACTCA
TCGCAGTCCAGAGACTTGAAACTGGCCAAATGCACTGACTTCCAGCTGGA
CAACGCTTCTGGCAATGCTCGTCTGATCTTCATCAGCTACAAGAAAGTGG
ATGATCCTCTACAGAGCCTAAAAAAGGCACTACTTGAGGAGCTGAATCTT
CCGGAACTTGTGGTCAGCCTAAAAGTGGTGAGGAGTGGGAAAAACCGCTT
AGTTTTTGAGCTGCCAAGTGCTCTGGATGCCCTCTTCACTCTGAATAGTT
TCTGCAATCGGTATCGCGATCGTCACGATCTCACCTATGAAATCATCAGC
GTTCAGAAGTGATTAAGTAATTAGACTTGACTTAGTATTGTAACATATAT
TGGTTAATAAAGTAAGAGAATGAGATGATTTTCAAACAAAAAAAAAAAAA
AAAAA
IP04634.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:50:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15394.a | 874 | CG15394.a | 199..787 | 1..589 | 2945 | 100 | Plus |
CG15394-RB | 722 | CG15394-RB | 47..635 | 1..589 | 2945 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:28:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 2592084..2592568 | 103..587 | 2425 | 100 | Plus |
chr2L | 23010047 | chr2L | 2591923..2592024 | 1..102 | 480 | 98 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:28:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2592289..2592775 | 103..589 | 2435 | 100 | Plus |
2L | 23513712 | 2L | 2592128..2592229 | 1..102 | 510 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2592289..2592775 | 103..589 | 2435 | 100 | Plus |
2L | 23513712 | 2L | 2592128..2592229 | 1..102 | 510 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 23:28:56 has no hits.
IP04634.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:29:58 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 2591923..2592024 | 1..102 | 98 | -> | Plus |
chr2L | 2592084..2592568 | 103..587 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:51 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RB | 47..558 | 1..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:52 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RB | 47..558 | 1..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:50 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RC | 1..480 | 33..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:04:53 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RB | 47..558 | 1..512 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:50:47 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RC | 1..480 | 33..512 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:33 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RB | 47..633 | 1..587 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:52 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RB | 47..633 | 1..587 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:50 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RC | 1..587 | 1..587 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:04:53 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RB | 47..633 | 1..587 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:50:47 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15394-RC | 1..587 | 1..587 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:58 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2592128..2592229 | 1..102 | 100 | -> | Plus |
2L | 2592289..2592773 | 103..587 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:58 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2592128..2592229 | 1..102 | 100 | -> | Plus |
2L | 2592289..2592773 | 103..587 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:58 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2592128..2592229 | 1..102 | 100 | -> | Plus |
2L | 2592289..2592773 | 103..587 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:50 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2592128..2592229 | 1..102 | 100 | -> | Plus |
arm_2L | 2592289..2592773 | 103..587 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:08 Download gff for
IP04634.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2592289..2592773 | 103..587 | 100 | | Plus |
2L | 2592128..2592229 | 1..102 | 100 | -> | Plus |
IP04634.pep Sequence
Translation from 2 to 511
> IP04634.pep
ISASKQVALAMRKMQILGFLFMWALICLGSCFAYPRAKTSYVNDFVFPTE
DEQVIRPWQQYSNEHSSQSRDLKLAKCTDFQLDNASGNARLIFISYKKVD
DPLQSLKKALLEELNLPELVVSLKVVRSGKNRLVFELPSALDALFTLNSF
CNRYRDRHDLTYEIISVQK*
IP04634.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24866-PA | 144 | GG24866-PA | 12..144 | 35..168 | 548 | 76.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15394-PD | 159 | CG15394-PD | 1..159 | 11..169 | 823 | 100 | Plus |
CG15394-PC | 159 | CG15394-PC | 1..159 | 11..169 | 823 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM11931-PA | 155 | GM11931-PA | 21..155 | 35..169 | 677 | 94.8 | Plus |
Dsec\GM18348-PA | 155 | GM18348-PA | 21..155 | 35..169 | 677 | 94.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23163-PA | 145 | GD23163-PA | 11..145 | 35..169 | 671 | 94.1 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:45:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ17362-PA | 163 | GJ17362-PA | 6..159 | 20..169 | 139 | 28.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18164-PA | 146 | GE18164-PA | 16..146 | 34..169 | 516 | 73.5 | Plus |
IP04634.hyp Sequence
Translation from 2 to 511
> IP04634.hyp
ISASKQVALAMRKMQILGFLFMWALICLGSCFAYPRAKTSYVNDFVFPTE
DEQVIRPWQQYSNEHSSQSRDLKLAKCTDFQLDNASGNARLIFISYKKVD
DPLQSLKKALLEELNLPELVVSLKVVRSGKNRLVFELPSALDALFTLNSF
CNRYRDRHDLTYEIISVQK*
IP04634.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15394-PD | 159 | CG15394-PD | 1..159 | 11..169 | 823 | 100 | Plus |
CG15394-PC | 159 | CG15394-PC | 1..159 | 11..169 | 823 | 100 | Plus |