Clone IP04642 Report

Search the DGRC for IP04642

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:42
Vector:pOT2
Associated Gene/TranscriptCG15638-RA
Protein status:IP04642.pep: gold
Preliminary Size:488
Sequenced Size:507

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15638 2005-01-01 Successful iPCR screen
CG15638 2008-04-29 Release 5.5 accounting
CG15638 2008-08-15 Release 5.9 accounting
CG15638 2008-12-18 5.12 accounting

Clone Sequence Records

IP04642.complete Sequence

507 bp (507 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023666

> IP04642.complete
AATTTTTGTGACAACAATCGACTAGAACGGAGATTATAATCCACCGCCCA
AGCTAGAATGCCGGAAACGAAACCCAAGACGCACTGCCGACCCAGCAATG
GCCTCGACCAGACGGAGGAGTCCGACACTCGTCTGGCTGCCAATCTGGTC
ACCCAAAGGAACCTCCAATTGCACCCACGTCCACAGCACCCACGCCCACA
GCGAGCTCGTCGAGATGCCACCGGCTTTACGTCCAACCAGGAGGTGCGGC
TAAAAGCCGGCGACATGCGCATGGCCCGGCTGCAGATCAGTCTCTCCCAG
CTGCGAACCGCAATGGAGGAGTCGGGCAAGCAGCTGAAGGACCTCTGCCA
GCAGGTGCGGTTGAATGTGGATGCTGAGTGAAGGGTCCTGGCTGAAGAAT
TCCTTTGCAAATGCATAATCATTCGGTTTAGGTGGTGCCAAATTCAAGTG
CTAACGATGAAATAAAGATAAAAAGAAATAATGTACATAAAAAAAAAAAA
AAAAAAA

IP04642.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG15638-RA 488 CG15638-RA 5..488 1..484 2420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:29:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13533973..13534460 488..1 2425 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13535289..13535778 490..1 2450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13535289..13535778 490..1 2450 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:29:18 has no hits.

IP04642.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:30:09 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13533973..13534460 1..488 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:55 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 1..324 58..381 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:42 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 1..324 58..381 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:05 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 1..324 58..381 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:09 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 1..324 58..381 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:51:12 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 1..324 58..381 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:06 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 5..488 1..484 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:42 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 5..488 1..484 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:05 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 1..488 1..488 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:09 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 5..488 1..484 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:51:12 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
CG15638-RA 1..488 1..488 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:09 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13535291..13535778 1..488 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:09 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13535291..13535778 1..488 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:09 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13535291..13535778 1..488 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:05 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13535291..13535778 1..488 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:42 Download gff for IP04642.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13535291..13535778 1..488 100   Minus

IP04642.hyp Sequence

Translation from 57 to 380

> IP04642.hyp
MPETKPKTHCRPSNGLDQTEESDTRLAANLVTQRNLQLHPRPQHPRPQRA
RRDATGFTSNQEVRLKAGDMRMARLQISLSQLRTAMEESGKQLKDLCQQV
RLNVDAE*

IP04642.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15638-PA 107 CG15638-PA 1..107 1..107 551 100 Plus

IP04642.pep Sequence

Translation from 57 to 380

> IP04642.pep
MPETKPKTHCRPSNGLDQTEESDTRLAANLVTQRNLQLHPRPQHPRPQRA
RRDATGFTSNQEVRLKAGDMRMARLQISLSQLRTAMEESGKQLKDLCQQV
RLNVDAE*

IP04642.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:10:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21633-PA 130 GF21633-PA 1..130 1..107 235 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10193-PA 107 GG10193-PA 1..107 1..107 431 88.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG15638-PA 107 CG15638-PA 1..107 1..107 551 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18214-PA 96 GI18214-PA 27..87 39..103 161 51.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25696-PA 110 GL25696-PA 1..110 1..107 234 49.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13864-PA 110 GA13864-PA 1..110 1..107 238 49.6 Plus
Dpse\GA27953-PA 110 GA27953-PA 1..110 1..107 234 49.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25444-PA 107 GM25444-PA 1..107 1..107 532 96.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19035-PA 114 GK19035-PA 1..111 1..105 195 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11547-PA 108 GE11547-PA 1..108 1..107 390 77.8 Plus