IP04642.complete Sequence
507 bp (507 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023666
> IP04642.complete
AATTTTTGTGACAACAATCGACTAGAACGGAGATTATAATCCACCGCCCA
AGCTAGAATGCCGGAAACGAAACCCAAGACGCACTGCCGACCCAGCAATG
GCCTCGACCAGACGGAGGAGTCCGACACTCGTCTGGCTGCCAATCTGGTC
ACCCAAAGGAACCTCCAATTGCACCCACGTCCACAGCACCCACGCCCACA
GCGAGCTCGTCGAGATGCCACCGGCTTTACGTCCAACCAGGAGGTGCGGC
TAAAAGCCGGCGACATGCGCATGGCCCGGCTGCAGATCAGTCTCTCCCAG
CTGCGAACCGCAATGGAGGAGTCGGGCAAGCAGCTGAAGGACCTCTGCCA
GCAGGTGCGGTTGAATGTGGATGCTGAGTGAAGGGTCCTGGCTGAAGAAT
TCCTTTGCAAATGCATAATCATTCGGTTTAGGTGGTGCCAAATTCAAGTG
CTAACGATGAAATAAAGATAAAAAGAAATAATGTACATAAAAAAAAAAAA
AAAAAAA
IP04642.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:46:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15638-RA | 488 | CG15638-RA | 5..488 | 1..484 | 2420 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:29:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 13533973..13534460 | 488..1 | 2425 | 99.8 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:29:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 13535289..13535778 | 490..1 | 2450 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 13535289..13535778 | 490..1 | 2450 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 23:29:18 has no hits.
IP04642.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:30:09 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 13533973..13534460 | 1..488 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:55 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 1..324 | 58..381 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:42 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 1..324 | 58..381 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:44:05 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 1..324 | 58..381 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:09 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 1..324 | 58..381 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:51:12 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 1..324 | 58..381 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:06 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 5..488 | 1..484 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:42 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 5..488 | 1..484 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:44:05 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 1..488 | 1..488 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:09 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 5..488 | 1..484 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:51:12 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15638-RA | 1..488 | 1..488 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:09 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13535291..13535778 | 1..488 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:09 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13535291..13535778 | 1..488 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:30:09 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13535291..13535778 | 1..488 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:44:05 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 13535291..13535778 | 1..488 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:42 Download gff for
IP04642.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13535291..13535778 | 1..488 | 100 | | Minus |
IP04642.hyp Sequence
Translation from 57 to 380
> IP04642.hyp
MPETKPKTHCRPSNGLDQTEESDTRLAANLVTQRNLQLHPRPQHPRPQRA
RRDATGFTSNQEVRLKAGDMRMARLQISLSQLRTAMEESGKQLKDLCQQV
RLNVDAE*
IP04642.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15638-PA | 107 | CG15638-PA | 1..107 | 1..107 | 551 | 100 | Plus |
IP04642.pep Sequence
Translation from 57 to 380
> IP04642.pep
MPETKPKTHCRPSNGLDQTEESDTRLAANLVTQRNLQLHPRPQHPRPQRA
RRDATGFTSNQEVRLKAGDMRMARLQISLSQLRTAMEESGKQLKDLCQQV
RLNVDAE*
IP04642.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:10:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF21633-PA | 130 | GF21633-PA | 1..130 | 1..107 | 235 | 46.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:10:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG10193-PA | 107 | GG10193-PA | 1..107 | 1..107 | 431 | 88.8 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15638-PA | 107 | CG15638-PA | 1..107 | 1..107 | 551 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:10:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI18214-PA | 96 | GI18214-PA | 27..87 | 39..103 | 161 | 51.5 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:10:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL25696-PA | 110 | GL25696-PA | 1..110 | 1..107 | 234 | 49.6 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:10:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13864-PA | 110 | GA13864-PA | 1..110 | 1..107 | 238 | 49.6 | Plus |
Dpse\GA27953-PA | 110 | GA27953-PA | 1..110 | 1..107 | 234 | 49.6 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:10:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25444-PA | 107 | GM25444-PA | 1..107 | 1..107 | 532 | 96.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:11:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19035-PA | 114 | GK19035-PA | 1..111 | 1..105 | 195 | 44.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:11:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE11547-PA | 108 | GE11547-PA | 1..108 | 1..107 | 390 | 77.8 | Plus |