BDGP Sequence Production Resources |
Search the DGRC for IP04645
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 46 |
Well: | 45 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15705-RA |
Protein status: | IP04645.pep: gold |
Preliminary Size: | 470 |
Sequenced Size: | 457 |
Gene | Date | Evidence |
---|---|---|
CG15705 | 2005-01-01 | Successful iPCR screen |
CG15705 | 2008-04-29 | Release 5.5 accounting |
CG15705 | 2008-08-15 | Release 5.9 accounting |
CG15705 | 2008-12-18 | 5.12 accounting |
457 bp (457 high quality bases) assembled on 2005-01-11
GenBank Submission: BT023663
> IP04645.complete ATTTTTGATAGCTGAGCAACAAAATCATACCAAATTCCCCTCTGAACATG GACAGCCCAGTAAAACAGCGCCTAAAACCCAAGAAGCTGGACAAACATCC AGGAACTCAGAAGGTCGAGTTCAAAAAGGATATCATCGATGAGGTAGCGG ATCAGTCGGTTGAATACGATTACATGAAGTATCCCAGCAATAAAGAGAAG GCAAAACTCCTGAAAGGCGTTAAACCATCGAAAAGTGTCACATTCAAGAC GGTGGTGGAGCTGGTGACCTATTCGGAAAACTGGAAGATGAAGATGAGCG AGAGCAGGCTGCGCTCGGAGGATGAGCAGCTGAAGAGCTCCCAAAAATAT CGCAACTACTGACAACTTTCCTTAAAATTATTGTTCGTTGTAAGCTAATA AATTGTTATGTGTTGATAAAAAAATATTTCGAGAAAAACTAAAAAAAAAA AAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 12168328..12168656 | 1..329 | 100 | -> | Plus |
chr2R | 12168872..12168982 | 330..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 1..315 | 48..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 1..315 | 48..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 1..315 | 48..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 1..315 | 48..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 1..315 | 48..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 26..465 | 1..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 26..465 | 1..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 26..465 | 1..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 26..465 | 1..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15705-RA | 26..465 | 1..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16280975..16281303 | 1..329 | 100 | -> | Plus |
2R | 16281519..16281629 | 330..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16280975..16281303 | 1..329 | 100 | -> | Plus |
2R | 16281519..16281629 | 330..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16280975..16281303 | 1..329 | 100 | -> | Plus |
2R | 16281519..16281629 | 330..440 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 12169024..12169134 | 330..440 | 100 | Plus | |
arm_2R | 12168480..12168808 | 1..329 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 16282174..16282502 | 1..329 | 100 | -> | Plus |
2R | 16282718..16282828 | 330..440 | 100 | Plus |
Translation from 47 to 361
> IP04645.hyp MDSPVKQRLKPKKLDKHPGTQKVEFKKDIIDEVADQSVEYDYMKYPSNKE KAKLLKGVKPSKSVTFKTVVELVTYSENWKMKMSESRLRSEDEQLKSSQK YRNY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15705-PA | 104 | CG15705-PA | 1..104 | 1..104 | 534 | 100 | Plus |
Translation from 47 to 361
> IP04645.pep MDSPVKQRLKPKKLDKHPGTQKVEFKKDIIDEVADQSVEYDYMKYPSNKE KAKLLKGVKPSKSVTFKTVVELVTYSENWKMKMSESRLRSEDEQLKSSQK YRNY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13585-PA | 109 | GF13585-PA | 1..109 | 1..104 | 236 | 52.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20589-PA | 108 | GG20589-PA | 1..108 | 1..104 | 322 | 66.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15705-PA | 104 | CG15705-PA | 1..104 | 1..104 | 534 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19245-PA | 116 | GI19245-PA | 39..113 | 32..102 | 170 | 46.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10723-PA | 88 | GL10723-PA | 14..87 | 31..103 | 146 | 43.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13901-PA | 88 | GA13901-PA | 14..87 | 31..103 | 145 | 43.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21679-PA | 109 | GM21679-PA | 1..109 | 1..104 | 452 | 85.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11180-PA | 109 | GD11180-PA | 1..109 | 1..104 | 463 | 86.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20322-PA | 104 | GJ20322-PA | 37..104 | 36..104 | 174 | 52.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19314-PA | 115 | GK19314-PA | 19..87 | 37..100 | 162 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11774-PA | 108 | GE11774-PA | 1..108 | 1..104 | 390 | 78 | Plus |