Clone IP04645 Report

Search the DGRC for IP04645

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:45
Vector:pOT2
Associated Gene/TranscriptCG15705-RA
Protein status:IP04645.pep: gold
Preliminary Size:470
Sequenced Size:457

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15705 2005-01-01 Successful iPCR screen
CG15705 2008-04-29 Release 5.5 accounting
CG15705 2008-08-15 Release 5.9 accounting
CG15705 2008-12-18 5.12 accounting

Clone Sequence Records

IP04645.complete Sequence

457 bp (457 high quality bases) assembled on 2005-01-11

GenBank Submission: BT023663

> IP04645.complete
ATTTTTGATAGCTGAGCAACAAAATCATACCAAATTCCCCTCTGAACATG
GACAGCCCAGTAAAACAGCGCCTAAAACCCAAGAAGCTGGACAAACATCC
AGGAACTCAGAAGGTCGAGTTCAAAAAGGATATCATCGATGAGGTAGCGG
ATCAGTCGGTTGAATACGATTACATGAAGTATCCCAGCAATAAAGAGAAG
GCAAAACTCCTGAAAGGCGTTAAACCATCGAAAAGTGTCACATTCAAGAC
GGTGGTGGAGCTGGTGACCTATTCGGAAAACTGGAAGATGAAGATGAGCG
AGAGCAGGCTGCGCTCGGAGGATGAGCAGCTGAAGAGCTCCCAAAAATAT
CGCAACTACTGACAACTTTCCTTAAAATTATTGTTCGTTGTAAGCTAATA
AATTGTTATGTGTTGATAAAAAAATATTTCGAGAAAAACTAAAAAAAAAA
AAAAAAA

IP04645.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-RA 577 CG15705-RA 138..577 1..440 2200 100 Plus
CG15705.a 467 CG15705.a 26..467 1..440 2155 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:16:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12168328..12168656 1..329 1645 100 Plus
chr2R 21145070 chr2R 12168870..12168982 328..440 565 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16280975..16281303 1..329 1645 100 Plus
2R 25286936 2R 16281517..16281634 328..445 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16282174..16282502 1..329 1645 100 Plus
2R 25260384 2R 16282716..16282833 328..445 590 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:16:11 has no hits.

IP04645.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:16:48 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12168328..12168656 1..329 100 -> Plus
chr2R 12168872..12168982 330..440 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:56 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 1..315 48..362 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:15:43 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 1..315 48..362 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:47:16 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 1..315 48..362 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:00:10 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 1..315 48..362 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:38:54 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 1..315 48..362 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:14:08 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 26..465 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:15:43 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 26..465 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:47:16 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 26..465 1..440 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:00:10 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 26..465 1..440 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:38:54 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
CG15705-RA 26..465 1..440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:48 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16280975..16281303 1..329 100 -> Plus
2R 16281519..16281629 330..440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:48 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16280975..16281303 1..329 100 -> Plus
2R 16281519..16281629 330..440 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:48 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16280975..16281303 1..329 100 -> Plus
2R 16281519..16281629 330..440 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:47:16 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12169024..12169134 330..440 100   Plus
arm_2R 12168480..12168808 1..329 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:35:43 Download gff for IP04645.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16282174..16282502 1..329 100 -> Plus
2R 16282718..16282828 330..440 100   Plus

IP04645.hyp Sequence

Translation from 47 to 361

> IP04645.hyp
MDSPVKQRLKPKKLDKHPGTQKVEFKKDIIDEVADQSVEYDYMKYPSNKE
KAKLLKGVKPSKSVTFKTVVELVTYSENWKMKMSESRLRSEDEQLKSSQK
YRNY*

IP04645.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-PA 104 CG15705-PA 1..104 1..104 534 100 Plus

IP04645.pep Sequence

Translation from 47 to 361

> IP04645.pep
MDSPVKQRLKPKKLDKHPGTQKVEFKKDIIDEVADQSVEYDYMKYPSNKE
KAKLLKGVKPSKSVTFKTVVELVTYSENWKMKMSESRLRSEDEQLKSSQK
YRNY*

IP04645.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:09:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13585-PA 109 GF13585-PA 1..109 1..104 236 52.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:09:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20589-PA 108 GG20589-PA 1..108 1..104 322 66.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15705-PA 104 CG15705-PA 1..104 1..104 534 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19245-PA 116 GI19245-PA 39..113 32..102 170 46.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:09:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10723-PA 88 GL10723-PA 14..87 31..103 146 43.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13901-PA 88 GA13901-PA 14..87 31..103 145 43.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21679-PA 109 GM21679-PA 1..109 1..104 452 85.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:09:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11180-PA 109 GD11180-PA 1..109 1..104 463 86.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:09:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20322-PA 104 GJ20322-PA 37..104 36..104 174 52.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19314-PA 115 GK19314-PA 19..87 37..100 162 49.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11774-PA 108 GE11774-PA 1..108 1..104 390 78 Plus