Clone IP04652 Report

Search the DGRC for IP04652

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:52
Vector:pOT2
Associated Gene/TranscriptCG42810-RA
Protein status:IP04652.pep: gold
Preliminary Size:462
Sequenced Size:486

Clone Sequence Records

IP04652.complete Sequence

486 bp assembled on 2010-06-23

GenBank Submission: BT125028.1

> IP04652.complete
AGAAAGTCGGCTTGTTTTTGACCAATTTGTATTTTCTTCAAAAATGTTTC
CCACCTATTCGATCAATGATGTCGCCGCCAATGAGGAAGTAGATCATACC
CAGCAAGACTTATCTTCAAAAGTCGAAGCCGATATGCAGTCGATCATTCG
TTTGGCCTACCAGGAGAACGAGGCTCTGATCCACCAAAAAGTTATGAGCG
CGATGAAGCAACGCGAAGAGGAGTTGGCCAAGCTGTGGGATATTCGATCA
TCATTATCAAGCTTAGCGCAGATCAGGGCTGCTCGTGATGAGGAACTAAG
AGCTCTATTGGACCAAATCGTTTCGAATGCGGACAGTAGCGATGAAGATG
AAGAAAAGGAAGATCCCTTTTAATGTCACCATCATCTGTTAATTAAATGC
TTGAGTGGCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP04652.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG16849-RA 462 CG16849-RA 229..462 140..373 1170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13458449..13458859 1..411 2055 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13459773..13460190 1..418 2090 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13459773..13460190 1..418 2090 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:51:02 has no hits.

IP04652.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:51:49 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13458449..13458859 1..411 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-06-23 16:55:37 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG16849-RA 229..462 140..373 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:37:12 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 1..330 44..373 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:52 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 1..330 44..373 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:52:26 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 1..330 44..373 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-23 16:55:36 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG16849-RA 229..462 140..373 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:37:11 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:52 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 1..411 1..411 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:52:26 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
CG42810-RA 93..503 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:49 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13459773..13460183 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:49 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13459773..13460183 1..411 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:49 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13459773..13460183 1..411 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:52 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13459773..13460183 1..411 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:52 Download gff for IP04652.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13459773..13460183 1..411 100   Plus

IP04652.hyp Sequence

Translation from 0 to 372

> IP04652.hyp
ESRLVFDQFVFSSKMFPTYSINDVAANEEVDHTQQDLSSKVEADMQSIIR
LAYQENEALIHQKVMSAMKQREEELAKLWDIRSSLSSLAQIRAARDEELR
ALLDQIVSNADSSDEDEEKEDPF*

IP04652.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:52:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42810-PA 109 CG16849-PA 1..109 15..123 536 100 Plus

IP04652.pep Sequence

Translation from 1 to 372

> IP04652.pep
ESRLVFDQFVFSSKMFPTYSINDVAANEEVDHTQQDLSSKVEADMQSIIR
LAYQENEALIHQKVMSAMKQREEELAKLWDIRSSLSSLAQIRAARDEELR
ALLDQIVSNADSSDEDEEKEDPF*

IP04652.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23854-PA 165 GG23854-PA 76..139 46..109 256 81.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG42810-PA 109 CG16849-PA 1..109 15..123 536 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10543-PA 155 GM10543-PA 76..139 46..109 269 82.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23901-PA 197 GD23901-PA 81..181 9..109 455 85.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18658-PA 159 GE18658-PA 76..139 46..109 233 76.6 Plus