Clone Sequence Records
IP04652.complete Sequence
486 bp assembled on 2010-06-23
GenBank Submission: BT125028.1
> IP04652.complete
AGAAAGTCGGCTTGTTTTTGACCAATTTGTATTTTCTTCAAAAATGTTTC
CCACCTATTCGATCAATGATGTCGCCGCCAATGAGGAAGTAGATCATACC
CAGCAAGACTTATCTTCAAAAGTCGAAGCCGATATGCAGTCGATCATTCG
TTTGGCCTACCAGGAGAACGAGGCTCTGATCCACCAAAAAGTTATGAGCG
CGATGAAGCAACGCGAAGAGGAGTTGGCCAAGCTGTGGGATATTCGATCA
TCATTATCAAGCTTAGCGCAGATCAGGGCTGCTCGTGATGAGGAACTAAG
AGCTCTATTGGACCAAATCGTTTCGAATGCGGACAGTAGCGATGAAGATG
AAGAAAAGGAAGATCCCTTTTAATGTCACCATCATCTGTTAATTAAATGC
TTGAGTGGCCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
IP04652.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:40:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG16849-RA | 462 | CG16849-RA | 229..462 | 140..373 | 1170 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:51:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 13458449..13458859 | 1..411 | 2055 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 13459773..13460190 | 1..418 | 2090 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 13459773..13460190 | 1..418 | 2090 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 18:51:02 has no hits.
IP04652.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:51:49 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 13458449..13458859 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-06-23 16:55:37 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16849-RA | 229..462 | 140..373 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:37:12 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42810-RA | 1..330 | 44..373 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:52 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42810-RA | 1..330 | 44..373 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:52:26 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42810-RA | 1..330 | 44..373 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-23 16:55:36 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG16849-RA | 229..462 | 140..373 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:37:11 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42810-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:52 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42810-RA | 1..411 | 1..411 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:52:26 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42810-RA | 93..503 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:49 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13459773..13460183 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:49 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13459773..13460183 | 1..411 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:51:49 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13459773..13460183 | 1..411 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:52 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 13459773..13460183 | 1..411 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:52 Download gff for
IP04652.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 13459773..13460183 | 1..411 | 100 | | Plus |
IP04652.hyp Sequence
Translation from 0 to 372
> IP04652.hyp
ESRLVFDQFVFSSKMFPTYSINDVAANEEVDHTQQDLSSKVEADMQSIIR
LAYQENEALIHQKVMSAMKQREEELAKLWDIRSSLSSLAQIRAARDEELR
ALLDQIVSNADSSDEDEEKEDPF*
IP04652.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:52:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42810-PA | 109 | CG16849-PA | 1..109 | 15..123 | 536 | 100 | Plus |
IP04652.pep Sequence
Translation from 1 to 372
> IP04652.pep
ESRLVFDQFVFSSKMFPTYSINDVAANEEVDHTQQDLSSKVEADMQSIIR
LAYQENEALIHQKVMSAMKQREEELAKLWDIRSSLSSLAQIRAARDEELR
ALLDQIVSNADSSDEDEEKEDPF*
IP04652.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:29:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23854-PA | 165 | GG23854-PA | 76..139 | 46..109 | 256 | 81.2 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42810-PA | 109 | CG16849-PA | 1..109 | 15..123 | 536 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:29:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM10543-PA | 155 | GM10543-PA | 76..139 | 46..109 | 269 | 82.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:29:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23901-PA | 197 | GD23901-PA | 81..181 | 9..109 | 455 | 85.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:29:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18658-PA | 159 | GE18658-PA | 76..139 | 46..109 | 233 | 76.6 | Plus |