Clone IP04668 Report

Search the DGRC for IP04668

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:68
Vector:pOT2
Associated Gene/TranscriptCG18643-RB
Protein status:IP04668.pep: gold
Preliminary Size:462
Sequenced Size:538

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18643 2005-01-01 Successful iPCR screen
CG18643 2008-04-29 Release 5.5 accounting
CG18643 2008-08-15 Release 5.9 accounting
CG18643 2008-12-18 5.12 accounting

Clone Sequence Records

IP04668.complete Sequence

538 bp (538 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022294

> IP04668.complete
CGGCACGAGTAAGAAATGCGTGCGGTTATACAAAGGGTTAAGGCTGCCAA
AGTGACGGTGTTGGATGAGCTGGTGTCCTCCATTGGACCAGGCCTGTGCG
TGCTGGTGGGAATCAAGGCCAGCGACACCGCCAAGGATGTTGAGTATCTT
GTCCGGAAAATCTTGGCTCTCCGTTTATTCGAGGAGGAGGGCAAGCGTTG
GCAAAAGTCCGTGAAGGATCTGAACCTAGAACTGCTGTGCGTCTCGCAGT
TTACACTGTATCACCGCCTTAAGGGCAACAAACCGGATTTTTTGGCTGCC
ATGAAGGGCGAGGAGGCGCAGGAGTTGTACAATCAATTTTTGGATCGCCT
AGGTCAATCCTACGATAGCACCAAGATTAAAGATGGCAAATTTGGAGCAT
ACATGCAAGTGCACATAGAAAACGATGGACCCGTAACCATTAATTTGGAG
TCCCCCGAACAAAAGGATACTGACAGAGAAGTGGACAAATGATTTGAAAA
TATATAACAACCAAAGACAAAAAAAAAAAAAAAAAAAA

IP04668.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG18643-RB 600 CG18643-RB 89..599 10..520 2555 100 Plus
CG18643.a 548 CG18643.a 33..547 10..520 2490 99.2 Plus
CG6764-RA 903 CG6764-RA 842..903 520..459 310 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7255809..7256041 150..382 1120 98.7 Plus
chr3R 27901430 chr3R 7256095..7256232 381..518 690 100 Plus
chr3R 27901430 chr3R 7255649..7255740 58..149 460 100 Plus
chr3R 27901430 chr3R 7255546..7255594 10..58 245 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11430339..11430571 150..382 1165 100 Plus
3R 32079331 3R 11430625..11430764 381..520 700 100 Plus
3R 32079331 3R 11430179..11430270 58..149 460 100 Plus
3R 32079331 3R 11430076..11430124 10..58 245 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11171170..11171402 150..382 1165 100 Plus
3R 31820162 3R 11171456..11171595 381..520 700 100 Plus
3R 31820162 3R 11171010..11171101 58..149 460 100 Plus
3R 31820162 3R 11170907..11170955 10..58 245 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:24:08 has no hits.

IP04668.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:24:54 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7255546..7255594 10..58 100 -> Plus
chr3R 7255650..7255740 59..149 100 -> Plus
chr3R 7255809..7256041 150..382 98 -> Plus
chr3R 7256097..7256232 383..518 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:24:59 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RA 1..373 16..388 99 == Plus
CG18643-RA 374..462 404..492 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:00 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RB 1..477 16..492 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:27:45 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RB 1..477 16..492 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:00 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RA 1..373 16..388 99 == Plus
CG18643-RA 374..462 404..492 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:05:36 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RB 1..477 16..492 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:41 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RA 1..373 16..388 99 == Plus
CG18643-RA 374..462 404..492 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:59 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RB 16..524 10..518 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:27:45 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RB 16..524 10..518 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:00 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RA 1..373 16..388 99 == Plus
CG18643-RA 374..462 404..492 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:05:36 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
CG18643-RB 16..524 10..518 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:54 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11430339..11430571 150..382 100 -> Plus
3R 11430627..11430762 383..518 100   Plus
3R 11430076..11430124 10..58 100 -> Plus
3R 11430180..11430270 59..149 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:54 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11430339..11430571 150..382 100 -> Plus
3R 11430627..11430762 383..518 100   Plus
3R 11430076..11430124 10..58 100 -> Plus
3R 11430180..11430270 59..149 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:24:54 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11430339..11430571 150..382 100 -> Plus
3R 11430627..11430762 383..518 100   Plus
3R 11430076..11430124 10..58 100 -> Plus
3R 11430180..11430270 59..149 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:27:45 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7255798..7255846 10..58 100 -> Plus
arm_3R 7255902..7255992 59..149 100 -> Plus
arm_3R 7256061..7256293 150..382 100 -> Plus
arm_3R 7256349..7256484 383..518 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:16 Download gff for IP04668.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11171170..11171402 150..382 100 -> Plus
3R 11171458..11171593 383..518 100   Plus
3R 11170907..11170955 10..58 100 -> Plus
3R 11171011..11171101 59..149 100 -> Plus

IP04668.pep Sequence

Translation from 15 to 491

> IP04668.pep
MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKIL
ALRLFEEEGKRWQKSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEE
AQELYNQFLDRLGQSYDSTKIKDGKFGAYMQVHIENDGPVTINLESPEQK
DTDREVDK*

IP04668.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16865-PA 50 GF16865-PA 6..50 114..158 179 73.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18145-PA 158 GG18145-PA 1..158 1..158 788 93.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21987-PA 158 GH21987-PA 1..158 1..158 710 85.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dtd-PB 158 CG18643-PB 1..158 1..158 802 100 Plus
Dtd-PC 45 CG18643-PC 1..45 1..45 215 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22701-PA 158 GI22701-PA 1..158 1..158 718 85.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:43:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12001-PA 158 GL12001-PA 1..158 1..158 702 83.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15029-PA 158 GA15029-PA 1..158 1..158 702 83.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23944-PA 158 GM23944-PA 1..158 1..158 817 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18754-PA 158 GD18754-PA 1..158 1..158 813 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23430-PA 158 GJ23430-PA 1..158 1..158 711 84.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11294-PA 159 GK11294-PA 1..159 1..158 669 80.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26095-PA 158 GE26095-PA 1..158 1..158 810 96.8 Plus

IP04668.hyp Sequence

Translation from 15 to 491

> IP04668.hyp
MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKIL
ALRLFEEEGKRWQKSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEE
AQELYNQFLDRLGQSYDSTKIKDGKFGAYMQVHIENDGPVTINLESPEQK
DTDREVDK*

IP04668.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG18643-PB 158 CG18643-PB 1..158 1..158 802 100 Plus
CG18643-PC 45 CG18643-PC 1..45 1..45 215 100 Plus