![]() | BDGP Sequence Production Resources |
Search the DGRC for IP04668
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 46 |
Well: | 68 |
Vector: | pOT2 |
Associated Gene/Transcript | CG18643-RB |
Protein status: | IP04668.pep: gold |
Preliminary Size: | 462 |
Sequenced Size: | 538 |
Gene | Date | Evidence |
---|---|---|
CG18643 | 2005-01-01 | Successful iPCR screen |
CG18643 | 2008-04-29 | Release 5.5 accounting |
CG18643 | 2008-08-15 | Release 5.9 accounting |
CG18643 | 2008-12-18 | 5.12 accounting |
538 bp (538 high quality bases) assembled on 2005-03-04
GenBank Submission: BT022294
> IP04668.complete CGGCACGAGTAAGAAATGCGTGCGGTTATACAAAGGGTTAAGGCTGCCAA AGTGACGGTGTTGGATGAGCTGGTGTCCTCCATTGGACCAGGCCTGTGCG TGCTGGTGGGAATCAAGGCCAGCGACACCGCCAAGGATGTTGAGTATCTT GTCCGGAAAATCTTGGCTCTCCGTTTATTCGAGGAGGAGGGCAAGCGTTG GCAAAAGTCCGTGAAGGATCTGAACCTAGAACTGCTGTGCGTCTCGCAGT TTACACTGTATCACCGCCTTAAGGGCAACAAACCGGATTTTTTGGCTGCC ATGAAGGGCGAGGAGGCGCAGGAGTTGTACAATCAATTTTTGGATCGCCT AGGTCAATCCTACGATAGCACCAAGATTAAAGATGGCAAATTTGGAGCAT ACATGCAAGTGCACATAGAAAACGATGGACCCGTAACCATTAATTTGGAG TCCCCCGAACAAAAGGATACTGACAGAGAAGTGGACAAATGATTTGAAAA TATATAACAACCAAAGACAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 7255809..7256041 | 150..382 | 1120 | 98.7 | Plus |
chr3R | 27901430 | chr3R | 7256095..7256232 | 381..518 | 690 | 100 | Plus |
chr3R | 27901430 | chr3R | 7255649..7255740 | 58..149 | 460 | 100 | Plus |
chr3R | 27901430 | chr3R | 7255546..7255594 | 10..58 | 245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 11430339..11430571 | 150..382 | 1165 | 100 | Plus |
3R | 32079331 | 3R | 11430625..11430764 | 381..520 | 700 | 100 | Plus |
3R | 32079331 | 3R | 11430179..11430270 | 58..149 | 460 | 100 | Plus |
3R | 32079331 | 3R | 11430076..11430124 | 10..58 | 245 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 11171170..11171402 | 150..382 | 1165 | 100 | Plus |
3R | 31820162 | 3R | 11171456..11171595 | 381..520 | 700 | 100 | Plus |
3R | 31820162 | 3R | 11171010..11171101 | 58..149 | 460 | 100 | Plus |
3R | 31820162 | 3R | 11170907..11170955 | 10..58 | 245 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 7255546..7255594 | 10..58 | 100 | -> | Plus |
chr3R | 7255650..7255740 | 59..149 | 100 | -> | Plus |
chr3R | 7255809..7256041 | 150..382 | 98 | -> | Plus |
chr3R | 7256097..7256232 | 383..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RA | 1..373 | 16..388 | 99 | == | Plus |
CG18643-RA | 374..462 | 404..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RB | 1..477 | 16..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RB | 1..477 | 16..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RA | 1..373 | 16..388 | 99 | == | Plus |
CG18643-RA | 374..462 | 404..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RB | 1..477 | 16..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RA | 1..373 | 16..388 | 99 | == | Plus |
CG18643-RA | 374..462 | 404..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RB | 16..524 | 10..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RB | 16..524 | 10..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RA | 1..373 | 16..388 | 99 | == | Plus |
CG18643-RA | 374..462 | 404..492 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18643-RB | 16..524 | 10..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11430339..11430571 | 150..382 | 100 | -> | Plus |
3R | 11430627..11430762 | 383..518 | 100 | Plus | |
3R | 11430076..11430124 | 10..58 | 100 | -> | Plus |
3R | 11430180..11430270 | 59..149 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11430339..11430571 | 150..382 | 100 | -> | Plus |
3R | 11430627..11430762 | 383..518 | 100 | Plus | |
3R | 11430076..11430124 | 10..58 | 100 | -> | Plus |
3R | 11430180..11430270 | 59..149 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11430339..11430571 | 150..382 | 100 | -> | Plus |
3R | 11430627..11430762 | 383..518 | 100 | Plus | |
3R | 11430076..11430124 | 10..58 | 100 | -> | Plus |
3R | 11430180..11430270 | 59..149 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 7255798..7255846 | 10..58 | 100 | -> | Plus |
arm_3R | 7255902..7255992 | 59..149 | 100 | -> | Plus |
arm_3R | 7256061..7256293 | 150..382 | 100 | -> | Plus |
arm_3R | 7256349..7256484 | 383..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11171170..11171402 | 150..382 | 100 | -> | Plus |
3R | 11171458..11171593 | 383..518 | 100 | Plus | |
3R | 11170907..11170955 | 10..58 | 100 | -> | Plus |
3R | 11171011..11171101 | 59..149 | 100 | -> | Plus |
Translation from 15 to 491
> IP04668.pep MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKIL ALRLFEEEGKRWQKSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEE AQELYNQFLDRLGQSYDSTKIKDGKFGAYMQVHIENDGPVTINLESPEQK DTDREVDK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16865-PA | 50 | GF16865-PA | 6..50 | 114..158 | 179 | 73.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18145-PA | 158 | GG18145-PA | 1..158 | 1..158 | 788 | 93.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21987-PA | 158 | GH21987-PA | 1..158 | 1..158 | 710 | 85.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dtd-PB | 158 | CG18643-PB | 1..158 | 1..158 | 802 | 100 | Plus |
Dtd-PC | 45 | CG18643-PC | 1..45 | 1..45 | 215 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI22701-PA | 158 | GI22701-PA | 1..158 | 1..158 | 718 | 85.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12001-PA | 158 | GL12001-PA | 1..158 | 1..158 | 702 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15029-PA | 158 | GA15029-PA | 1..158 | 1..158 | 702 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23944-PA | 158 | GM23944-PA | 1..158 | 1..158 | 817 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18754-PA | 158 | GD18754-PA | 1..158 | 1..158 | 813 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23430-PA | 158 | GJ23430-PA | 1..158 | 1..158 | 711 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11294-PA | 159 | GK11294-PA | 1..159 | 1..158 | 669 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26095-PA | 158 | GE26095-PA | 1..158 | 1..158 | 810 | 96.8 | Plus |
Translation from 15 to 491
> IP04668.hyp MRAVIQRVKAAKVTVLDELVSSIGPGLCVLVGIKASDTAKDVEYLVRKIL ALRLFEEEGKRWQKSVKDLNLELLCVSQFTLYHRLKGNKPDFLAAMKGEE AQELYNQFLDRLGQSYDSTKIKDGKFGAYMQVHIENDGPVTINLESPEQK DTDREVDK*