Clone IP04672 Report

Search the DGRC for IP04672

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:46
Well:72
Vector:pOT2
Associated Gene/TranscriptCG34445-RA
Protein status:IP04672.pep: gold
Preliminary Size:477
Sequenced Size:520

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30219 2005-01-01 Successful iPCR screen
CG34445 2008-04-29 Release 5.5 accounting
CG34445 2008-08-15 Release 5.9 accounting
CG34445 2008-12-18 5.12 accounting

Clone Sequence Records

IP04672.complete Sequence

520 bp (520 high quality bases) assembled on 2005-03-04

GenBank Submission: BT022289

> IP04672.complete
ATGACGACAACGCTGCCGGAGAAGGAAGCGGAAACGCAGCAGGAGATCAG
GGAGCGGGAGGCCAAGGCTCTGGAGGACCGAAAGGAGCGCAAGATCTACG
AGAACTTTGCCACGCCCCTGGCAGGCACTTTTCTCAACCTGCCACGCGAG
CCCGTGGAGATCGAGTGCCCCGCCTGCGGAATCAAGGATCTGAGTGTGGT
GCAAAATGATCTGAAGTGGTGGGCCAGTGAACTAAACCGCATTGTGGGAT
GTCTTTTTGTGACCTTCTGCTGCTGCTGCTGCTTTAATTACTATGTGCCG
TGCAAACAAACCGATCGAAGTCATTACTGCGGCAATTGCGGCTGTTACTT
TGGACGTTCCATGAAGAGGAGGCAACCACTCAAATTGAAGGCAACCACCG
CCTAGGCAGCATTGTTCACATATTTATTAAAATTCTTCTAAACACTCAAT
TTCCCACCCACTACTGCAATACCATCGAAACAAAAATAAAGCCAAAAATA
TCAAAAAAAAAAAAAAAAAA

IP04672.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34445-RA 640 CG34445-RA 123..625 1..503 2515 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:12:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18534759..18535019 261..1 1305 100 Minus
chr2R 21145070 chr2R 18534458..18534699 502..261 1150 98.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:43:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22648193..22648453 261..1 1305 100 Minus
2R 25286936 2R 22647891..22648133 503..261 1215 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22649392..22649652 261..1 1305 100 Minus
2R 25260384 2R 22649090..22649332 503..261 1215 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:12:02 has no hits.

IP04672.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:12:51 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18534458..18534699 261..502 98 <- Minus
chr2R 18534760..18535019 1..260 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:25:01 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 1..405 1..405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:01 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 1..405 1..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:46:02 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 1..405 1..405 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:01 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 1..405 1..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:13:40 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 1..405 1..405 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:21:43 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 21..522 1..502 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:01 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 21..522 1..502 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:46:02 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 26..527 1..502 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:25 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 21..522 1..502 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:13:40 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
CG34445-RA 26..527 1..502 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:51 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22647892..22648133 261..502 100 <- Minus
2R 22648194..22648453 1..260 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:51 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22647892..22648133 261..502 100 <- Minus
2R 22648194..22648453 1..260 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:12:51 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22647892..22648133 261..502 100 <- Minus
2R 22648194..22648453 1..260 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:46:02 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18535699..18535958 1..260 100   Minus
arm_2R 18535397..18535638 261..502 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:17 Download gff for IP04672.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22649091..22649332 261..502 100 <- Minus
2R 22649393..22649652 1..260 100   Minus

IP04672.pep Sequence

Translation from 0 to 404

> IP04672.pep
MTTTLPEKEAETQQEIREREAKALEDRKERKIYENFATPLAGTFLNLPRE
PVEIECPACGIKDLSVVQNDLKWWASELNRIVGCLFVTFCCCCCFNYYVP
CKQTDRSHYCGNCGCYFGRSMKRRQPLKLKATTA*

IP04672.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13580-PA 155 GF13580-PA 2..80 3..81 317 74.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21773-PA 180 GG21773-PA 1..96 1..96 413 82.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22105-PA 152 GH22105-PA 14..81 20..87 298 79.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34445-PA 134 CG34445-PA 1..134 1..134 744 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19240-PA 140 GI19240-PA 23..79 31..87 250 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:43:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10717-PA 155 GL10717-PA 7..84 11..88 327 76.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15727-PA 155 GA15727-PA 7..84 11..88 327 76.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15624-PA 78 GM15624-PA 1..78 1..78 401 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:43:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20315-PA 160 GJ20315-PA 34..89 32..87 266 87.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21853-PA 146 GK21853-PA 19..139 21..118 298 53.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:43:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11849-PA 168 GE11849-PA 1..87 1..87 405 89.7 Plus

IP04672.hyp Sequence

Translation from 1 to 404

> IP04672.hyp
MTTTLPEKEAETQQEIREREAKALEDRKERKIYENFATPLAGTFLNLPRE
PVEIECPACGIKDLSVVQNDLKWWASELNRIVGCLFVTFCCCCCFNYYVP
CKQTDRSHYCGNCGCYFGRSMKRRQPLKLKATTA*

IP04672.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG34445-PA 134 CG34445-PA 1..134 1..134 744 100 Plus